Tel:
+49 (0)241 95 163 153
Fax:
+49 (0)241 95 163 155
E-Mail:
orders@anticorps-enligne.fr

DC-SIGN/CD209 anticorps

L’anticorps anti-DC-SIGN/CD209 Polyclonal Lapin est utilisé pour la détection de DC-SIGN/CD209 dans des échantillons de Humain, Souris et Rat. Il a été validé pour WB, FACS et IHC (p).
N° du produit ABIN5647543
644,88 €
Plus frais de livraison 40,00 € et TVA
100 μg
Destination: France
Envoi sous 6 à 9 jours ouvrables

Aperçu rapide pour DC-SIGN/CD209 anticorps (ABIN5647543)

Antigène

Voir toutes DC-SIGN/CD209 (CD209) Anticorps
DC-SIGN/CD209 (CD209) (CD209)

Reactivité

  • 132
  • 27
  • 20
  • 1
  • 1
Humain, Souris, Rat

Hôte

  • 82
  • 64
  • 5
  • 1
Lapin

Clonalité

  • 79
  • 73
Polyclonal

Conjugué

  • 66
  • 11
  • 11
  • 8
  • 7
  • 4
  • 3
  • 3
  • 3
  • 3
  • 3
  • 3
  • 3
  • 2
  • 2
  • 1
  • 1
  • 1
  • 1
  • 1
  • 1
  • 1
  • 1
  • 1
  • 1
  • 1
  • 1
  • 1
  • 1
  • 1
  • 1
  • 1
  • 1
  • 1
  • 1
Cet anticorp DC-SIGN/CD209 est non-conjugé

Application

  • 73
  • 56
  • 49
  • 35
  • 28
  • 19
  • 13
  • 8
  • 6
  • 6
  • 4
  • 3
  • 3
  • 2
  • 2
  • 1
  • 1
  • 1
  • 1
Western Blotting (WB), Flow Cytometry (FACS), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))
  • Purification

    Antigen affinity purified

    Immunogène

    Amino acids MSDSKEPRLQQLGLLEEEQLRGLGFRQTRGYKSLA were used as the immunogen for the DC-SIGN antibody.

    Isotype

    IgG
  • Indications d'application

    Optimal dilution of the DC-SIGN antibody should be determined by the researcher.\. Western Blot: 0.5-1 μg/mL,IHC (FFPE): 1-2 μg/mL,FACS: 1-3 μg/10^6 cells

    Restrictions

    For Research Use only
  • Buffer

    0.5 mg/mL if reconstituted with 0.2 mL sterile DI water

    Stock

    -20 °C

    Stockage commentaire

    After reconstitution, the DC-SIGN antibody can be stored for up to one month at 4°C. For long-term, aliquot and store at -20°C. Avoid repeated freezing and thawing.
  • Antigène

    DC-SIGN/CD209 (CD209) (CD209)

    Autre désignation

    DC-SIGN / CD209

    Sujet

    DC-SIGN (Dendritic Cell-Specific Intercellular adhesion molecule-3-Grabbing Non-integrin) also known as CD209 (Cluster of Differentiation 209) is a protein which in humans is encoded by the CD209 gene. This gene encodes a transmembrane receptor and is often referred to as DC-SIGN because of its expression on the surface of dendritic cells and macrophages. The encoded protein is involved in the innate immune system and recognizes numerous evolutionarily divergent pathogens ranging from parasites to viruses with a large impact on public health. The protein is organized into three distinct domains: an N-terminal transmembrane domain, a tandem-repeat neck domain and C-type lectin carbohydrate recognition domain. The extracellular region consisting of the C-type lectin and neck domains has a dual function as a pathogen recognition receptor and a cell adhesion receptor by binding carbohydrate ligands on the surface of microbes and endogenous cells. The neck region is important for homo-oligomerization which allows the receptor to bind multivalent ligands with high avidity. Variations in the number of 23 amino acid repeats in the neck domain of this protein are rare but have a significant impact on ligand binding ability. This gene is closely related in terms of both sequence and function to a neighboring gene. DC-SIGN and L-SIGN differ in their ligand-binding properties and distribution. Alternative splicing results in multiple variants.

    UniProt

    Q9NNX6
Vous êtes ici:
Chat with us!