DC-SIGN/CD209 anticorps

N° du produit ABIN5647543

Détail du produit anti-DC-SIGN/CD209 anticorps

Antigène: DC-SIGN/CD209 (CD209) (CD209)

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp DC-SIGN/CD209 est non-conjugé

Application: Western Blotting (WB), Flow Cytometry (FACS), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))

Purification: Antigen affinity purified

Immunogène: Amino acids MSDSKEPRLQQLGLLEEEQLRGLGFRQTRGYKSLA were used as the immunogen for the DC-SIGN antibody.

Isotype: IgG

Information d'application

Indications d'application: Optimal dilution of the DC-SIGN antibody should be determined by the researcher.\. Western Blot: 0.5-1 μg/mL,IHC (FFPE): 1-2 μg/mL,FACS: 1-3 μg/10^6 cells

Restrictions: For Research Use only

Stockage

Buffer: 0.5 mg/mL if reconstituted with 0.2 mL sterile DI water

Stock: -20 °C

Stockage commentaire: After reconstitution, the DC-SIGN antibody can be stored for up to one month at 4°C. For long-term, aliquot and store at -20°C. Avoid repeated freezing and thawing.

Détails sur DC-SIGN/CD209

Antigène: DC-SIGN/CD209 (CD209) (CD209)

Autre désignation: DC-SIGN / CD209 (CD209 Produits)

Synonymes: anticorps CDSIGN, anticorps CLEC4L, anticorps DC-SIGN, anticorps DC-SIGN1, anticorps cd209, anticorps CLEC4M, anticorps si:ch211-224h1.3, anticorps CD209, anticorps CIRE, anticorps Dcsign, anticorps SIGN-R1, anticorps SIGNR5, anticorps Cd209, anticorps CD209 molecule, anticorps CD209a antigen, anticorps CD209 antigen-like protein D, anticorps CD209c molecule, anticorps CD209 antigen, anticorps CD209, anticorps cd209, anticorps Cd209a, anticorps LOC100529184, anticorps Cd209c, anticorps LOC100460708, anticorps LOC105484282

Sujet: DC-SIGN (Dendritic Cell-Specific Intercellular adhesion molecule-3-Grabbing Non-integrin) also known as CD209 (Cluster of Differentiation 209) is a protein which in humans is encoded by the CD209 gene. This gene encodes a transmembrane receptor and is often referred to as DC-SIGN because of its expression on the surface of dendritic cells and macrophages. The encoded protein is involved in the innate immune system and recognizes numerous evolutionarily divergent pathogens ranging from parasites to viruses with a large impact on public health. The protein is organized into three distinct domains: an N-terminal transmembrane domain, a tandem-repeat neck domain and C-type lectin carbohydrate recognition domain. The extracellular region consisting of the C-type lectin and neck domains has a dual function as a pathogen recognition receptor and a cell adhesion receptor by binding carbohydrate ligands on the surface of microbes and endogenous cells. The neck region is important for homo-oligomerization which allows the receptor to bind multivalent ligands with high avidity. Variations in the number of 23 amino acid repeats in the neck domain of this protein are rare but have a significant impact on ligand binding ability. This gene is closely related in terms of both sequence and function to a neighboring gene. DC-SIGN and L-SIGN differ in their ligand-binding properties and distribution. Alternative splicing results in multiple variants.

UniProt: Q9NNX6