DVL2 anticorps (AA 35-64)

N° du produit ABIN5647553

Détail du produit anti-DVL2 anticorps

Antigène: DVL2 (Dishevelled, Dsh Homolog 2 (Drosophila) (DVL2))

Épitope: AA 35-64

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp DVL2 est non-conjugé

Application: Western Blotting (WB)

Purification: Antigen affinity purified

Immunogène: Amino acids 35-64 (AERITLGDFKSVLQRPAGAKYFFKSMDQDF) from the human protein were used as the immunogen for the Dishevelled 2 antibody.

Isotype: IgG

Information d'application

Indications d'application: Optimal dilution of the Dishevelled 2 antibody should be determined by the researcher.\. WB: 0.5-1 μg/mL

Restrictions: For Research Use only

Stockage

Buffer: 0.5 mg/mL if reconstituted with 0.2 mL sterile DI water

Stock: -20 °C

Stockage commentaire: After reconstitution, the Dishevelled 2 antibody can be stored for up to one month at 4°C. For long-term, aliquot and store at -20°C. Avoid repeated freezing and thawing.

Détails sur DVL2

Antigène: DVL2 (Dishevelled, Dsh Homolog 2 (Drosophila) (DVL2))

Autre désignation: Dishevelled 2 / DVL2 (DVL2 Produits)

Synonymes: anticorps Xdsh, anticorps dishevelled, anticorps dsh, anticorps dvl, anticorps Dvl-2, anticorps xdsh, anticorps wu:fc05d12, anticorps wu:fo71e09, anticorps wu:fp54a02, anticorps zgc:55372, anticorps dishevelled segment polarity protein 2, anticorps dishevelled segment polarity protein 2 L homeolog, anticorps DVL2, anticorps dvl2, anticorps Dvl2, anticorps dvl2.L

Sujet: Segment polarity protein dishevelled homolog DVL-2 is a protein that in humans is encoded by the DVL2 gene. This gene encodes a member of the dishevelled (dsh) protein family. The vertebrate dsh proteins have approximately 40 % amino acid sequence similarity with Drosophila dsh. This gene encodes a 90-kD protein that undergoes posttranslational phosphorylation to form a 95-kD cytoplasmic protein, which may play a role in the signal transduction pathway mediated by multiple Wnt proteins. The mechanisms of dishevelled function in Wnt signaling are likely to be conserved among metazoans.

UniProt: O14641

Pathways: Tube Formation