ATOH1 anticorps (AA 1-30)

N° du produit ABIN5647595

Cet anticorps anti-ATOH1 est un anticorps Lapin Polyclonal détectant ATOH1 dans WB. Adapté pour Souris et Rat.

Aperçu rapide pour ATOH1 anticorps (AA 1-30) (ABIN5647595)

Antigène: ATOH1 (Atonal Homolog 1 (Drosophila) (ATOH1))

Reactivité: Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp ATOH1 est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-ATOH1 anticorps

Épitope: AA 1-30

Réactivité croisée (Details): Expected species reactivity: Human

Purification: Antigen affinity purified

Immunogène: Amino acids 1-30 (MSRLLHAEEWAEVKELGDHHRQPQPHHLPQ) were used as the immunogen for the ATOH1 antibody.

Isotype: IgG

Information d'application

Indications d'application: Optimal dilution of the ATOH1 antibody should be determined by the researcher.\. Western Blot: 0.5-1 μg/mL

Restrictions: For Research Use only

Stockage

Buffer: 0.5 mg/mL if reconstituted with 0.2 mL sterile DI water

Stock: -20 °C

Stockage commentaire: After reconstitution, the ATOH1 antibody can be stored for up to one month at 4°C. For long-term, aliquot and store at -20°C. Avoid repeated freezing and thawing.

Détails sur ATOH1

Antigène: ATOH1 (Atonal Homolog 1 (Drosophila) (ATOH1))

Autre désignation: ATOH1 / MATH1

Sujet: Protein atonal homolog 1 is a protein that in humans is encoded by the ATOH1 gene. This protein belongs to the basic helix-loop-helix (BHLH) family of transcription factors. It activates E-box dependent transcription along with E47. ATOH1 is required for the formation of both neural and non-neural cell types. Using genetic deletion in mice, Atoh1 has been shown to be essential for formation of cerebellar granule neurons, inner ear hair cells, spinal cord interneurons, Merkel cells of the skin, and intestinal secretory cells (goblet, enteroendocrine, and Paneth cells).

UniProt: Q92858