TNFAIP6 anticorps (AA 46-91)

N° du produit ABIN5647620

Détail du produit anti-TNFAIP6 anticorps

Antigène: TNFAIP6 (Tumor Necrosis Factor-Inducible Protein 6 (TNFAIP6))

Épitope: AA 46-91

Reactivité: Humain, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp TNFAIP6 est non-conjugé

Application: Western Blotting (WB)

Purification: Antigen affinity purified

Immunogène: Amino acids 46-91 (KYKLTYAEAKAVCEFEGGHLATYKQLEAARKIGFHVCAAGWMAKGR) from the human protein were used as the immunogen for the TSG6 antibody.

Isotype: IgG

Information d'application

Indications d'application: Optimal dilution of the TSG6 antibody should be determined by the researcher.\. WB: 0.5-1 μg/mL

Restrictions: For Research Use only

Stockage

Buffer: 0.5 mg/mL if reconstituted with 0.2 mL sterile DI water

Stock: -20 °C

Stockage commentaire: After reconstitution, the TSG6 antibody can be stored for up to one month at 4°C. For long-term, aliquot and store at -20°C. Avoid repeated freezing and thawing.

Détails sur TNFAIP6

Antigène: TNFAIP6 (Tumor Necrosis Factor-Inducible Protein 6 (TNFAIP6))

Autre désignation: TSG6 (TNFAIP6 Produits)

Synonymes: anticorps Tnfip6, anticorps TSG-6, anticorps Tsg6, anticorps TSG6, anticorps TNF alpha induced protein 6, anticorps tumor necrosis factor alpha induced protein 6, anticorps Tnfaip6, anticorps TNFAIP6

Sujet: Tumor necrosis factor-inducible gene 6 protein, also known as TSG-6, is a protein that in humans is encoded by the TNFAIP6 gene. The protein encoded by this gene is a secretory protein that contains a hyaluronan-binding domain, and thus is a member of the hyaluronan-binding protein family. The hyaluronan-binding domain is known to be involved in extracellular matrix stability and cell migration. This protein has been shown to form a stable complex with inter-alpha-inhibitor (I alpha I), and thus enhance the serine protease inhibitory activity of I alpha I, which is important in the protease network associated with inflammation. This gene can be induced by proinflammatory cytokines such as tumor necrosis factor alpha and interleukin-1. Enhanced levels of this protein are found in the synovial fluid of patients with osteoarthritis and rheumatoid arthritis.

UniProt: P98066