ADAM2 anticorps (AA 231-274)

N° du produit ABIN5647674

Détail du produit anti-ADAM2 anticorps

Antigène: ADAM2 (ADAM Metallopeptidase Domain 2 (ADAM2))

Épitope: AA 231-274

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp ADAM2 est non-conjugé

Application: Western Blotting (WB)

Purification: Antigen affinity purified

Immunogène: Amino acids 231-274 (WIDENKIATTGEANELLHTFLRWKTSYLVLRPHDVAFLLVYREK) from the human protein were used as the immunogen for the ADAM2 antibody.

Isotype: IgG

Information d'application

Indications d'application: Optimal dilution of the ADAM2 antibody should be determined by the researcher.\. WB: 0.5-1 μg/mL

Restrictions: For Research Use only

Stockage

Buffer: 0.5 mg/mL if reconstituted with 0.2 mL sterile DI water

Stock: -20 °C

Stockage commentaire: After reconstitution, the ADAM2 antibody can be stored for up to one month at 4°C. For long-term, aliquot and store at -20°C. Avoid repeated freezing and thawing.

Détails sur ADAM2

Antigène: ADAM2 (ADAM Metallopeptidase Domain 2 (ADAM2))

Autre désignation: ADAM2 (ADAM2 Produits)

Synonymes: anticorps AI323749, anticorps Ftnb, anticorps Ph30-beta, anticorps CRYN1, anticorps CRYN2, anticorps CT15, anticorps FTNB, anticorps PH-30b, anticorps PH30, anticorps PH30-beta, anticorps PH-30, anticorps a disintegrin and metallopeptidase domain 2, anticorps ADAM metallopeptidase domain 2, anticorps Adam2, anticorps ADAM2

Sujet: ADAM2 (A Disintegrin and Metalloproteinase Domain 2), also known as FTNB or PH30, is an enzyme that in humans is encoded by the ADAM2 gene. This gene encodes a member of the ADAM (a disintegrin and metalloprotease domain) family. Members of this family are membrane-anchored proteins structurally related to snake venom disintegrins, and have been implicated in a variety of biological processes involving cell-cell and cell-matrix interactions, including fertilization, muscle development, and neurogenesis. This member is a subunit of an integral sperm membrane glycoprotein called fertilin, which plays an important role in sperm-egg interactions. This gene is mapped to 8p11.2.

UniProt: Q99965