TECTA anticorps (AA 93-134)

N° du produit ABIN5647724

Cet anticorps anti-TECTA Polyclonal Lapin (ABIN5647724) détecte spécifiquement TECTA dans WB et IHC (p). L’anticorps est réactif avec des échantillons de Humain, Souris et Rat.

Aperçu rapide pour TECTA anticorps (AA 93-134) (ABIN5647724)

Antigène: TECTA (Tectorin alpha (TECTA))

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp TECTA est non-conjugé

Application: Western Blotting (WB), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))

Détail du produit anti-TECTA anticorps

Épitope: AA 93-134

Fonction: TECTA Antibody / Alpha Tectorin

Séquence: RAFVAPFWAD VHNGIRGEIY YRETMEPAIL KRATKDIRKY FK

Purification: Antigen affinity

Immunogène: Amino acids 93-134 (RAFVAPFWADVHNGIRGEIYYRETMEPAILKRATKDIRKYFK) from human Alpha Tectorin were used as the immunogen for the TECTA antibody.

Isotype: IgG

Information d'application

Indications d'application: Optimal dilution of the TECTA antibody should be determined by the researcher.

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Buffer: 0.5 mg/mL if reconstituted with 0.2 mL sterile DI water

Stock: 4 °C,-20 °C

Stockage commentaire: After reconstitution, the TECTA antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20oC. Avoid repeated freezing and thawing.

Détails sur TECTA

Antigène: TECTA (Tectorin alpha (TECTA))

Autre désignation: TECTA

Sujet: Alpha Tectorin is a protein that in humans is encoded by the TECTA gene. The tectorial membrane is an extracellular matrix of the inner ear that contacts the stereocilia bundles of specialized sensory hair cells. Sound induces movement of these hair cells relative to the tectorial membrane, deflects the stereocilia, and leads to fluctuations in hair-cell membrane potential, transducing sound into electrical signals. Alpha-tectorin is one of the major noncollagenous components of the tectorial membrane. Mutations in the TECTA gene have been shown to be responsible for autosomal dominant nonsyndromic hearing impairment and a recessive form of sensorineural pre-lingual non-syndromic deafness.

UniProt: O75443

Pathways: Sensory Perception of Sound