OTC anticorps (AA 33-70)

N° du produit ABIN5647747

L’anticorps Lapin Polyclonal anti-OTC a été validé pour WB. Il convient pour détecter OTC dans des échantillons de Souris et Rat.

Aperçu rapide pour OTC anticorps (AA 33-70) (ABIN5647747)

Antigène: OTC (Ornithine Carbamoyltransferase (OTC))

Reactivité: Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp OTC est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-OTC anticorps

Épitope: AA 33-70

Réactivité croisée (Details): Expected species reactivity: Human

Purification: Antigen affinity purified

Immunogène: Amino acids 33-70 (NKVQLKGRDLLTLKNFTGEEIKYMLWLSADLKFRIKQK) from the human protein were used as the immunogen for the OTC antibody.

Isotype: IgG

Information d'application

Indications d'application: Optimal dilution of the OTC antibody should be determined by the researcher.\. WB: 0.5-1 μg/mL

Restrictions: For Research Use only

Stockage

Buffer: 0.5 mg/mL if reconstituted with 0.2 mL sterile DI water

Stock: -20 °C

Stockage commentaire: After reconstitution, the OTC antibody can be stored for up to one month at 4°C. For long-term, aliquot and store at -20°C. Avoid repeated freezing and thawing.

Détails sur OTC

Antigène: OTC (Ornithine Carbamoyltransferase (OTC))

Autre désignation: OTC (Ornithine carbamoyltransferase)

Sujet: Ornithine transcarbamylase (OTC) (also called ornithine carbamoyltransferase) is an enzyme that catalyzes the reaction between carbamoyl phosphate (CP) and ornithine (Orn) to form citrulline (Cit) and phosphate (Pi). This nuclear gene encodes a mitochondrial matrix enzyme. Missense, nonsense, and frameshift mutations in this enzyme lead to ornithine transcarbamylase deficiency, which causes hyperammonemia. Since the gene for this enzyme maps close to that for Duchenne muscular dystrophy, it may also play a role in that disease.

UniProt: P00480