KRIT1 anticorps (AA 703-736)

N° du produit ABIN5647767

Cet anticorps Lapin Polyclonal détecte spécifiquement KRIT1 dans WB. Il présente une réactivité avec des échantillons de Humain, Souris et Rat.

Aperçu rapide pour KRIT1 anticorps (AA 703-736) (ABIN5647767)

Antigène: KRIT1 (KRIT1, Ankyrin Repeat Containing (KRIT1))

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp KRIT1 est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-KRIT1 anticorps

Épitope: AA 703-736

Fonction: KRIT1 Antibody / CCM1

Séquence: ENKMSFIVHT KQAGLVVKLL MKLNGQLMPT ERNS

Purification: Antigen affinity

Immunogène: Amino acids 703-736 (ENKMSFIVHTKQAGLVVKLLMKLNGQLMPTERNS) from the human protein were used as the immunogen for the KRIT1 antibody.

Isotype: IgG

Information d'application

Indications d'application: Differences in protocols and secondary/substrate sensitivity may require the KRIT1 antibody to be titrated for optimal performance.

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Buffer: 0.5 mg/mL if reconstituted with 0.2 mL sterile DI water

Stock: 4 °C,-20 °C

Stockage commentaire: After reconstitution, the KRIT1 antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20oC. Avoid repeated freezing and thawing.

Détails sur KRIT1

Antigène: KRIT1 (KRIT1, Ankyrin Repeat Containing (KRIT1))

Autre désignation: KRIT1

Sujet: Krev interaction trapped protein 1 is a protein that in humans is encoded by the CCM1 gene. This gene encodes a protein containing four ankyrin repeats, a band 4.1/ezrin/radixin/moesin (FERM) domain, and multiple NPXY sequences. The encoded protein is localized in the nucleus and cytoplasm. It binds to integrin cytoplasmic domain-associated protein-1 alpha (ICAP1alpha), and plays a critical role in beta1-integrin-mediated cell proliferation. It associates with junction proteins and RAS-related protein 1A (Rap1A), which requires the encoded protein for maintaining the integrity of endothelial junctions. It is also a microtubule-associated protein and may play a role in microtubule targeting. Mutations in this gene result in cerebral cavernous malformations. Multiple alternatively spliced transcript variants have been found for this gene.

UniProt: O00522

Pathways: Cell RedoxHomeostasis