KRIT1 anticorps (AA 703-736)

N° du produit ABIN5647767

Détail du produit anti-KRIT1 anticorps

Antigène: KRIT1 (KRIT1, Ankyrin Repeat Containing (KRIT1))

Épitope: AA 703-736

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp KRIT1 est non-conjugé

Application: Western Blotting (WB)

Purification: Antigen affinity purified

Immunogène: Amino acids 703-736 (ENKMSFIVHTKQAGLVVKLLMKLNGQLMPTERNS) from the human protein were used as the immunogen for the KRIT1 antibody.

Isotype: IgG

Information d'application

Indications d'application: Western blot: 0.5-1 μg/mL

Restrictions: For Research Use only

Stockage

Buffer: 0.5 mg/mL if reconstituted with 0.2 mL sterile DI water

Stock: -20 °C

Stockage commentaire: After reconstitution, the KRIT1 antibody can be stored for up to one month at 4°C. For long-term, aliquot and store at -20°C. Avoid repeated freezing and thawing.

Détails sur KRIT1

Antigène: KRIT1 (KRIT1, Ankyrin Repeat Containing (KRIT1))

Autre désignation: KRIT1 (KRIT1 Produits)

Synonymes: anticorps CAM, anticorps CCM1, anticorps 2010007K12Rik, anticorps A630036P20Rik, anticorps AA432855, anticorps AI450393, anticorps AI643869, anticorps BB155247, anticorps BB235701, anticorps Ccm1, anticorps RGD1305929, anticorps krit1, anticorps fb36f07, anticorps san, anticorps santa, anticorps wu:fb36f07, anticorps zgc:63585, anticorps KRIT1, ankyrin repeat containing, anticorps KRIT1, anticorps Krit1, anticorps krit1

Sujet: Krev interaction trapped protein 1 is a protein that in humans is encoded by the CCM1 gene. This gene encodes a protein containing four ankyrin repeats, a band 4.1/ezrin/radixin/moesin (FERM) domain, and multiple NPXY sequences. The encoded protein is localized in the nucleus and cytoplasm. It binds to integrin cytoplasmic domain-associated protein-1 alpha (ICAP1alpha), and plays a critical role in beta1-integrin-mediated cell proliferation. It associates with junction proteins and RAS-related protein 1A (Rap1A), which requires the encoded protein for maintaining the integrity of endothelial junctions. It is also a microtubule-associated protein and may play a role in microtubule targeting. Mutations in this gene result in cerebral cavernous malformations. Multiple alternatively spliced transcript variants have been found for this gene.

UniProt: O00522

Pathways: Cell RedoxHomeostasis