12-Lipoxygenase anticorps (AA 186-231)

N° du produit ABIN5647834

L’anticorps Lapin Polyclonal anti-12-Lipoxygenase a été validé pour WB. Il convient pour détecter 12-Lipoxygenase dans des échantillons de Humain, Souris et Rat.

Aperçu rapide pour 12-Lipoxygenase anticorps (AA 186-231) (ABIN5647834)

Antigène: 12-Lipoxygenase (LOX12)

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp 12-Lipoxygenase est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-12-Lipoxygenase anticorps

Épitope: AA 186-231

Purification: Antigen affinity purified

Immunogène: Amino acids 186-231 (ALKRVYTLLSSWNCLEDFDQIFWGQKSALAEKVRQCWQDDELFSYQ) from the human protein were used as the immunogen for the 12 Lipoxygenase antibody.

Isotype: IgG

Information d'application

Indications d'application: Optimal dilution of the 12 Lipoxygenase antibody should be determined by the researcher.\. WB: 0.5-1 μg/mL

Restrictions: For Research Use only

Stockage

Buffer: 0.5 mg/mL if reconstituted with 0.2 mL sterile DI water

Stock: -20 °C

Stockage commentaire: After reconstitution, the 12 Lipoxygenase antibody can be stored for up to one month at 4°C. For long-term, aliquot and store at -20°C. Avoid repeated freezing and thawing.

Détails sur 12-Lipoxygenase

Antigène: 12-Lipoxygenase (LOX12)

Autre désignation: 12 Lipoxygenase

Sujet: ALOX12 (Arachidonate 12-lipoxygenase) is an enzyme that in humans is encoded by the ALOX12 gene. By fluorescence in situ hybridization, the gene is located in band 17p13.1. The gene consists of 14 exons with 13 introns and spans approximately 15 kb of DNA Arachidonate 12-lipoxygenase introduces a molecular oxygen into the C-12 position of arachidonic acid to produce 12(S)-hydroperoxy-5,8,10,14-eicosatetraenoic acid. The major pathway of arachidonic acid metabolism in human platelets proceeds via a 12-lipoxygenase enzyme. Expression of the LOG12 gene was detected in human erythroleukemia cells, platelets, and human umbilical vein endothelial cells by reverse transcription-PCR analysis.

UniProt: P18054