DHODH anticorps (AA 132-173)

N° du produit ABIN5647841

Cet anticorps anti-DHODH est un anticorps Lapin Polyclonal détectant DHODH dans WB et IHC (p). Adapté pour Humain, Souris et Rat.

Aperçu rapide pour DHODH anticorps (AA 132-173) (ABIN5647841)

Antigène: DHODH (Dihydroorotate Dehydrogenase (DHODH))

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp DHODH est non-conjugé

Application: Western Blotting (WB), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))

Détail du produit anti-DHODH anticorps

Épitope: AA 132-173

Purification: Antigen affinity purified

Immunogène: Amino acids 132-173 (RVFRLPEDQAVINRYGFNSHGLSVVEHRLRARQQKQAKLTED) from the human protein were used as the immunogen for the DHODH antibody.

Isotype: IgG

Information d'application

Indications d'application: Western blot: 0.5-1 μg/mL,IHC (FFPE): 1-2 μg/mL

Restrictions: For Research Use only

Stockage

Buffer: 0.5 mg/mL if reconstituted with 0.2 mL sterile DI water

Stock: -20 °C

Stockage commentaire: After reconstitution, the DHODH antibody can be stored for up to one month at 4°C. For long-term, aliquot and store at -20°C. Avoid repeated freezing and thawing.

Détails sur DHODH

Antigène: DHODH (Dihydroorotate Dehydrogenase (DHODH))

Autre désignation: DHODH

Sujet: Dihydroorotate dehydrogenase is an enzyme that in humans is encoded by the DHODH gene on chromosome 16. The protein encoded by this gene catalyzes the fourth enzymatic step, the ubiquinone-mediated oxidation of dihydroorotate to orotate, in de novo pyrimidine biosynthesis. This protein is a mitochondrial protein located on the outer surface of the inner mitochondrial membrane.

UniProt: Q02127

Pathways: Ribonucleoside Biosynthetic Process, Protein targeting to Nucleus