ADAM28 anticorps (AA 207-248)

N° du produit ABIN5647843

Détail du produit anti-ADAM28 anticorps

Antigène: ADAM28 (ADAM Metallopeptidase Domain 28 (ADAM28))

Épitope: AA 207-248

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp ADAM28 est non-conjugé

Application: Western Blotting (WB)

Purification: Antigen affinity purified

Immunogène: Amino acids 207-248 (EYYLVLDNGEFKRYNENQDEIRKRVFEMANYVNMLYKKLNTH) from the human protein were used as the immunogen for the ADAM28 antibody.

Isotype: IgG

Information d'application

Indications d'application: Optimal dilution of the ADAM28 antibody should be determined by the researcher.\. WB: 0.5-1 μg/mL

Restrictions: For Research Use only

Stockage

Buffer: 0.5 mg/mL if reconstituted with 0.2 mL sterile DI water

Stock: -20 °C

Stockage commentaire: After reconstitution, the ADAM28 antibody can be stored for up to one month at 4°C. For long-term, aliquot and store at -20°C. Avoid repeated freezing and thawing.

Détails sur ADAM28

Antigène: ADAM28 (ADAM Metallopeptidase Domain 28 (ADAM28))

Autre désignation: ADAM28 (ADAM28 Produits)

Synonymes: anticorps C130072N01Rik, anticorps D430033C21Rik, anticorps Dtgn1, anticorps MDC-L, anticorps MDC-Lm, anticorps MDC-Ls, anticorps MDCL, anticorps TECADAM, anticorps eMDCII, anticorps ADAM 28, anticorps ADAM23, anticorps eMDC II, anticorps ADAM metallopeptidase domain 28, anticorps a disintegrin and metallopeptidase domain 28, anticorps Adam28, anticorps ADAM28

Sujet: Disintegrin and metalloproteinase domain-containing protein 28 is an enzyme that in humans is encoded by the ADAM28 gene. This gene encodes a member of the ADAM (a disintegrin and metalloprotease domain) family. Members of this family are membrane-anchored proteins structurally related to snake venom disintegrins, and have been implicated in a variety of biological processes involving cell-cell and cell-matrix interactions, including fertilization, muscle development, and neurogenesis. The protein encoded by this gene is a lymphocyte-expressed ADAM protein. And this gene is present in a gene cluster with other members of the ADAM family on chromosome 8. Alternative splicing results in multiple transcript variants.

UniProt: Q9UKQ2