ETS1 anticorps (AA 67-98)

N° du produit ABIN5647852

L’anticorps Lapin Polyclonal anti-ETS1 a été validé pour WB. Il convient pour détecter ETS1 dans des échantillons de Humain et Souris.

Aperçu rapide pour ETS1 anticorps (AA 67-98) (ABIN5647852)

Antigène: ETS1 (V-Ets erythroblastosis Virus E26 Oncogene Homolog 1 (Avian) (ETS1))

Reactivité: Humain, Souris

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp ETS1 est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-ETS1 anticorps

Épitope: AA 67-98

Purification: Antigen affinity purified

Immunogène: Amino acids 67-98 (KDPRQWTETHVRDWVMWAVNEFSLKGVDFQKF) from the human protein were used as the immunogen for the ETS1 antibody.

Isotype: IgG

Information d'application

Indications d'application: Optimal dilution of the ETS1 antibody should be determined by the researcher.\. WB: 0.5-1 μg/mL

Restrictions: For Research Use only

Stockage

Buffer: 0.5 mg/mL if reconstituted with 0.2 mL sterile DI water

Stock: -20 °C

Stockage commentaire: After reconstitution, the ETS1 antibody can be stored for up to one month at 4°C. For long-term, aliquot and store at -20°C. Avoid repeated freezing and thawing.

Détails sur ETS1

Antigène: ETS1 (V-Ets erythroblastosis Virus E26 Oncogene Homolog 1 (Avian) (ETS1))

Autre désignation: ETS1

Sujet: Protein C-ets-1 is a protein that in humans is encoded by the ETS1 gene. It is mapped to 11q24.3. This gene encodes a member of the ETS family of transcription factors, which are defined by the presence of a conserved ETS DNA-binding domain that recognizes the core consensus DNA sequence GGAA/T in target genes. These proteins function either as transcriptional activators or repressors of numerous genes, and are involved in stem cell development, cell senescence and death, and tumorigenesis.

UniProt: P14921