MSI1 anticorps (AA 21-54)

N° du produit ABIN5647867

Détail du produit anti-MSI1 anticorps

Antigène: MSI1 (Musashi Homolog 1 (Drosophila) (MSI1))

Épitope: AA 21-54

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp MSI1 est non-conjugé

Application: Western Blotting (WB), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))

Purification: Antigen affinity purified

Immunogène: Amino acids 21-54 (KMFIGGLSWQTTQEGLREYFGQFGEVKECLVMRD) from the human protein were used as the immunogen for the Musashi antibody.

Isotype: IgG

Information d'application

Indications d'application: Optimal dilution of the Musashi antibody should be determined by the researcher.\. WB: 0.5-1 μg/mL,IHC (FFPE): 1-2 μg/mL

Restrictions: For Research Use only

Stockage

Buffer: 0.5 mg/mL if reconstituted with 0.2 mL sterile DI water

Stock: -20 °C

Stockage commentaire: After reconstitution, the Musashi antibody can be stored for up to one month at 4°C. For long-term, aliquot and store at -20°C. Avoid repeated freezing and thawing.

Détails sur MSI1

Antigène: MSI1 (Musashi Homolog 1 (Drosophila) (MSI1))

Autre désignation: MSI1 / Musashi 1 (MSI1 Produits)

Synonymes: anticorps CG5099, anticorps DMSIDNA, anticorps Dmel\\CG5099, anticorps Msi, anticorps SIDNA, anticorps anon-EST:Liang-2.35, anticorps clone 2.35, anticorps Msi1h, anticorps Musashi, anticorps Musashi-1, anticorps Musashi1, anticorps XNrp-1, anticorps nrp-1B, anticorps Dsim\\GD21224, anticorps GD21224, anticorps dsim_GLEANR_4982, anticorps msi, anticorps musashi, anticorps Musahi1, anticorps m-Msi-1, anticorps msi1h, anticorps musashi, anticorps musashi RNA binding protein 1, anticorps GD21224 gene product from transcript GD21224-RD, anticorps musashi RNA-binding protein 1, anticorps musashi RNA binding protein 1 S homeolog, anticorps msi, anticorps msi1, anticorps Dsim\msi, anticorps MSI1, anticorps Msi1, anticorps msi1.S

Sujet: RNA-binding protein Musashi homolog 1 is a protein that in humans is encoded by the MSI1 gene. This gene encodes a protein containing two conserved tandem RNA recognition motifs. Similar proteins in other species function as RNA-binding proteins and play central roles in posttranscriptional gene regulation. Expression of this gene has been correlated with the grade of the malignancy and proliferative activity in gliomas and melanomas. A pseudogene for this gene is located on chromosome 11q13.

UniProt: O43347

Pathways: Stem Cell Maintenance