MSI1 anticorps (AA 21-54)

N° du produit ABIN5647867

L’anticorps anti-MSI1 Polyclonal Lapin est utilisé pour la détection de MSI1 dans des échantillons de Humain, Souris et Rat. Il a été validé pour WB, IF et IHC (p).

Aperçu rapide pour MSI1 anticorps (AA 21-54) (ABIN5647867)

Antigène: MSI1 (Musashi Homolog 1 (Drosophila) (MSI1))

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp MSI1 est non-conjugé

Application: Western Blotting (WB), Immunofluorescence (IF), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))

Détail du produit anti-MSI1 anticorps

Épitope: AA 21-54

Fonction: Musashi Antibody / MSI1

Séquence: KMFIGGLSWQ TTQEGLREYF GQFGEVKECL VMRD

Purification: Antigen affinity

Immunogène: Amino acids 21-54 (KMFIGGLSWQTTQEGLREYFGQFGEVKECLVMRD) from the human protein were used as the immunogen for the Musashi antibody.

Isotype: IgG

Information d'application

Indications d'application: Optimal dilution of the Musashi antibody should be determined by the researcher.

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Buffer: 0.5 mg/mL if reconstituted with 0.2 mL sterile DI water

Stock: 4 °C,-20 °C

Stockage commentaire: After reconstitution, the Musashi antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20oC. Avoid repeated freezing and thawing.

Détails sur MSI1

Antigène: MSI1 (Musashi Homolog 1 (Drosophila) (MSI1))

Autre désignation: MSI1 / Musashi 1

Sujet: RNA-binding protein Musashi homolog 1 is a protein that in humans is encoded by the MSI1 gene. This gene encodes a protein containing two conserved tandem RNA recognition motifs. Similar proteins in other species function as RNA-binding proteins and play central roles in posttranscriptional gene regulation. Expression of this gene has been correlated with the grade of the malignancy and proliferative activity in gliomas and melanomas. A pseudogene for this gene is located on chromosome 11q13.

UniProt: O43347

Pathways: Stem Cell Maintenance