MMP11 anticorps (AA 104-135)

N° du produit ABIN5647881

Détail du produit anti-MMP11 anticorps

Antigène: MMP11 (Matrix Metallopeptidase 11 (Stromelysin 3) (MMP11))

Épitope: AA 104-135

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp MMP11 est non-conjugé

Application: Western Blotting (WB), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))

Purification: Antigen affinity purified

Immunogène: Amino acids 104-135 (RWEKTDLTYRILRFPWQLVQEQVRQTMAEALK) from the human protein were used as the immunogen for the MMP11 antibody.

Isotype: IgG

Information d'application

Indications d'application: Optimal dilution of the MMP11 antibody should be determined by the researcher.\. WB: 0.5-1 μg/mL,IHC (FFPE): 1-2 μg/mL

Restrictions: For Research Use only

Stockage

Buffer: 0.5 mg/mL if reconstituted with 0.2 mL sterile DI water

Stock: -20 °C

Stockage commentaire: After reconstitution, the MMP11 antibody can be stored for up to one month at 4°C. For long-term, aliquot and store at -20°C. Avoid repeated freezing and thawing.

Détails sur MMP11

Antigène: MMP11 (Matrix Metallopeptidase 11 (Stromelysin 3) (MMP11))

Autre désignation: MMP11 (MMP11 Produits)

Synonymes: anticorps SL-3, anticorps ST3, anticorps STMY3, anticorps Stmy3, anticorps MMP-11, anticorps matrix metallopeptidase 11, anticorps matrix metallopeptidase 11 L homeolog, anticorps stromelysin-3, anticorps MMP11, anticorps Mmp11, anticorps mmp11.L, anticorps LOC103694874

Sujet: Stromelysin-3 (SL-3) also known as matrix metalloproteinase-11 (MMP-11) is an enzyme that in humans is encoded by the MMP11 gene. Proteins of the matrix metalloproteinase (MMP) family are involved in the breakdown of extracellular matrix in normal physiological processes, such as embryonic development, reproduction, and tissue remodeling, as well as in disease processes, such as arthritis and metastasis. Most MMP's are secreted as inactive proproteins which are activated when cleaved by extracellular proteinases. However, the enzyme encoded by this gene is activated intracellularly by furin within the constitutive secretory pathway. Also in contrast to other MMP's, this enzyme cleaves alpha 1-proteinase inhibitor but weakly degrades structural proteins of the extracellular matrix.

UniProt: P24347