Peptide YY anticorps (AA 29-64)

N° du produit ABIN5647902

Cet anticorps Lapin Polyclonal détecte spécifiquement Peptide YY dans WB et IHC (p). Il présente une réactivité envers Souris et Rat.

Aperçu rapide pour Peptide YY anticorps (AA 29-64) (ABIN5647902)

Antigène: Peptide YY (PYY)

Reactivité: Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp Peptide YY est non-conjugé

Application: Western Blotting (WB), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))

Détail du produit anti-Peptide YY anticorps

Épitope: AA 29-64

Purification: Antigen affinity purified

Immunogène: Amino acids 29-64 (YPAKPEAPGEDASPEELSRYYASLRHYLNLVTRQRY) from the mouse protein were used as the immunogen for the PYY antibody.

Isotype: IgG

Information d'application

Indications d'application: Western blot: 0.5-1 μg/mL,IHC (FFPE): 1-2 μg/mL

Restrictions: For Research Use only

Stockage

Buffer: 0.5 mg/mL if reconstituted with 0.2 mL sterile DI water

Stock: -20 °C

Stockage commentaire: Prior to reconstitution, store at 4°C. After reconstitution, the PYY antibody can be stored for up to one month at 4°C. For long-term, aliquot and store at -20°C. Avoid repeated freezing and thawing.

Détails sur Peptide YY

Antigène: Peptide YY (PYY)

Autre désignation: PYY / Peptide YY

Sujet: Peptide YY (PYY), also known as peptide tyrosine tyrosine, is a peptide that in humans is encoded by the PYY gene. This gene encodes a member of the neuropeptide Y (NPY) family of peptides. The encoded preproprotein is proteolytically processed to generate two alternative peptide products that differ in length by three amino acids. These peptides, secreted by endocrine cells in the gut, exhibit different binding affinities for each of the neuropeptide Y receptors. Binding of the encoded peptides to these receptors mediates regulation of pancreatic secretion, gut mobility and energy homeostasis. Rare variations in this gene could increase susceptibility to obesity and elevated serum levels of the encoded peptides may be associated with anorexia nervosa.

UniProt: Q9EPS2