Peptide YY anticorps (AA 29-64)

N° du produit ABIN5647902

Cet anticorps Lapin Polyclonal détecte spécifiquement Peptide YY dans IF et IHC (p). Il présente une réactivité avec des échantillons de Rat et Souris.

Aperçu rapide pour Peptide YY anticorps (AA 29-64) (ABIN5647902)

Antigène: Peptide YY (PYY)

Reactivité: Rat, Souris

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp Peptide YY est non-conjugé

Application: Immunofluorescence (IF), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))

Détail du produit anti-Peptide YY anticorps

Épitope: AA 29-64

Fonction: PYY Antibody / Peptide YY

Séquence: YPAKPEAPGE DASPEELSRY YASLRHYLNL VTRQRY

Purification: Antigen affinity

Immunogène: Amino acids 29-64 (YPAKPEAPGEDASPEELSRYYASLRHYLNLVTRQRY) from the mouse protein were used as the immunogen for the PYY antibody.

Isotype: IgG

Information d'application

Indications d'application: Optimal dilution of the PYY antibody should be determined by the researcher.

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Buffer: 0.5 mg/mL if reconstituted with 0.2 mL sterile DI water

Stock: 4 °C,-20 °C

Stockage commentaire: Prior to reconstitution, store at 4oC. After reconstitution, the PYY antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20oC. Avoid repeated freezing and thawing.

Détails sur Peptide YY

Antigène: Peptide YY (PYY)

Autre désignation: PYY

Sujet: Peptide YY (PYY), also known as peptide tyrosine tyrosine, is a peptide that in humans is encoded by the PYY gene. This gene encodes a member of the neuropeptide Y (NPY) family of peptides. The encoded preproprotein is proteolytically processed to generate two alternative peptide products that differ in length by three amino acids. These peptides, secreted by endocrine cells in the gut, exhibit different binding affinities for each of the neuropeptide Y receptors. Binding of the encoded peptides to these receptors mediates regulation of pancreatic secretion, gut mobility and energy homeostasis. Rare variations in this gene could increase susceptibility to obesity and elevated serum levels of the encoded peptides may be associated with anorexia nervosa.

UniProt: Q9EPS2