PVRL4 anticorps (AA 53-94)

N° du produit ABIN5647906

L’anticorps anti-PVRL4 Polyclonal Lapin est utilisé pour la détection de PVRL4 dans des échantillons de Humain. Il a été validé pour WB.

Aperçu rapide pour PVRL4 anticorps (AA 53-94) (ABIN5647906)

Antigène: PVRL4 (Poliovirus Receptor-Related 4 (PVRL4))

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp PVRL4 est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-PVRL4 anticorps

Épitope: AA 53-94

Fonction: Nectin-4 Antibody / PVRL4

Séquence: FYRGDSGEQV GQVAWARVDA GEGAQELALL HSKYGLHVSP AY

Purification: Antigen affinity

Immunogène: Amino acids 53-94 (FYRGDSGEQVGQVAWARVDAGEGAQELALLHSKYGLHVSPAY) from the human protein were used as the immunogen for the Nectin-4 antibody.

Isotype: IgG

Information d'application

Indications d'application: Differences in protocols and secondary/substrate sensitivity may require the Nectin-4 antibody to be titrated for optimal performance.

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Buffer: 0.5 mg/mL if reconstituted with 0.2 mL sterile DI water

Stock: 4 °C,-20 °C

Stockage commentaire: After reconstitution, the Nectin-4 antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20oC. Avoid repeated freezing and thawing.

Détails sur PVRL4

Antigène: PVRL4 (Poliovirus Receptor-Related 4 (PVRL4))

Autre désignation: Nectin-4

Sujet: PVRL4, also known as Nectin-4, is expressed in human skin, hair follicles, and cultured keratinocytes, but not in fibroblasts. This gene encodes a member of the nectin family. The encoded protein contains two immunoglobulin-like (Ig-like) C2-type domains and one Ig-like V-type domain. It is involved in cell adhesion through trans-homophilic and -heterophilic interactions. It is a single-pass type I membrane protein. The soluble form is produced by proteolytic cleavage at the cell surface by the metalloproteinase ADAM17/TACE. The secreted form is found in both breast tumor cell lines and breast tumor patients. Mutations in this gene are the cause of ectodermal dysplasia-syndactyly syndrome type 1, an autosomal recessive disorder. Alternatively spliced transcript variants have been found but the full-length nature of the variant has not been determined.

UniProt: Q96NY8

Pathways: Cell-Cell Junction Organization