NAA15 anticorps (AA 244-287)

N° du produit ABIN5647934

Cet anticorps anti-NAA15 Polyclonal Lapin (ABIN5647934) détecte spécifiquement NAA15 dans WB et IHC (p). L’anticorps est réactif avec des échantillons de Humain et Souris.

Aperçu rapide pour NAA15 anticorps (AA 244-287) (ABIN5647934)

Antigène: NAA15 (N(alpha)-Acetyltransferase 15, NatA Auxiliary Subunit (NAA15))

Reactivité: Humain, Souris

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp NAA15 est non-conjugé

Application: Western Blotting (WB), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))

Détail du produit anti-NAA15 anticorps

Épitope: AA 244-287

Purification: Antigen affinity purified

Immunogène: Amino acids 244-287 (ADVYRGLQERNPENWAYYKGLEKALKPANMLERLKIYEEAWTKY) from the human protein were used as the immunogen for the NARG1 antibody.

Isotype: IgG

Information d'application

Indications d'application: Optimal dilution of the NARG1 antibody should be determined by the researcher.\. WB: 0.5-1 μg/mL,IHC (FFPE): 1-2 μg/mL

Restrictions: For Research Use only

Stockage

Buffer: 0.5 mg/mL if reconstituted with 0.2 mL sterile DI water

Stock: -20 °C

Stockage commentaire: After reconstitution, the NARG1 antibody can be stored for up to one month at 4°C. For long-term, aliquot and store at -20°C. Avoid repeated freezing and thawing.

Détails sur NAA15

Antigène: NAA15 (N(alpha)-Acetyltransferase 15, NatA Auxiliary Subunit (NAA15))

Autre désignation: NARG1 / NAA15

Sujet: NMDA receptor-regulated protein 1 (NARG1), also known as GA19 or Tbdn100 is a protein that in humans is encoded by the NAA15 gene. It is mapped to chromosome 4. NARG1 is the auxiliary subunit of the NatA (N-alpha-acetyltransferase A) complex. Both, Naa15 and Naa16 interact with the ribosome in yeast (via the ribosomal proteins, uL23 and uL29), humans and rat, thereby linking the NatA/Naa10 to the ribosome and facilitating co-translational acetylation of nascent polypeptide chains as they emerges from the exit tunnel. Furthermore, Naa15 might act as a scaffold for other factors, including the chaperone like protein HYPK (Huntingtin Interacting Protein K) and Naa50, the catalytic acetyltransferase subunit of NatE.

UniProt: Q9BXJ9