ALDH7A1 anticorps (AA 333-369)

N° du produit ABIN5647986

Cet anticorps Lapin Polyclonal détecte spécifiquement ALDH7A1 dans WB et IHC (p). Il présente une réactivité envers Humain, Souris et Rat.

Aperçu rapide pour ALDH7A1 anticorps (AA 333-369) (ABIN5647986)

Antigène: ALDH7A1 (Aldehyde Dehydrogenase 7 Family, Member A1 (ALDH7A1))

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp ALDH7A1 est non-conjugé

Application: Western Blotting (WB), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))

Détail du produit anti-ALDH7A1 anticorps

Épitope: AA 333-369

Purification: Antigen affinity purified

Immunogène: Amino acids 333-369 (ARRLFIHESIHDEVVNRLKKAYAQIRVGNPWDPNVLY) from the human protein were used as the immunogen for the ALDH7A1 antibody.

Isotype: IgG

Information d'application

Indications d'application: Western blot: 0.5-1 μg/mL,IHC (FFPE): 1-2 μg/mL

Restrictions: For Research Use only

Stockage

Buffer: 0.5 mg/mL if reconstituted with 0.2 mL sterile DI water

Stock: -20 °C

Stockage commentaire: After reconstitution, the ALDH7A1 antibody can be stored for up to one month at 4°C. For long-term, aliquot and store at -20°C. Avoid repeated freezing and thawing.

Détails sur ALDH7A1

Antigène: ALDH7A1 (Aldehyde Dehydrogenase 7 Family, Member A1 (ALDH7A1))

Autre désignation: ALDH7A1

Sujet: Aldehyde dehydrogenase 7 family, member A1, also known as ALDH7A1 or antiquitin, is an enzyme that in humans is encoded by the ALDH7A1 gene. The protein encoded by this gene is a member of subfamily 7 in the aldehyde dehydrogenase gene family. These enzymes are thought to play a major role in the detoxification of aldehydes generated by alcohol metabolism andlipid peroxidation. This particular member has homology to a previously described protein from the green garden pea, the 26g pea turgor protein. It is also involved in lysine catabolism that is known to occur in the mitochondrial matrix. Recent reports show that this protein is found both in the cytosol and the mitochondria, and the two forms likely arise from the use of alternative translation initiation sites. An additional variant encoding a different isoform has also been found for this gene. Mutations in this gene are associated with pyridoxine-dependent epilepsy. Several related pseudogenes have also been identified.

UniProt: P49419

Pathways: Sensory Perception of Sound