FABP5 anticorps

N° du produit ABIN5692847

Détail du produit anti-FABP5 anticorps

Antigène: FABP5 (Fatty Acid Binding Protein 5 (Psoriasis-Associated) (FABP5))

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp FABP5 est non-conjugé

Application: Western Blotting (WB), Immunohistochemistry (IHC)

Marque: Picoband™

Séquence: KWRLMESHGF EEYMKELGVG LALRKMAAMA KPD

Réactivité croisée (Details): No cross reactivity with other proteins.

Attributs du produit: Rabbit IgG polyclonal antibody for FABP5 detection. Tested with WB, IHC-P in Human,Mouse,Rat.

Immunogène: A synthetic peptide corresponding to a sequence of human FABP5 (KWRLMESHGFEEYMKELGVGLALRKMAAMAKPD).

Information d'application

Indications d'application:

Recommended Detection Systems: Enhanced Chemiluminescent Kit with anti-Rabbit IgG (ABIN921124) for Western blot, and HRP Conjugated anti-Rabbit IgG Super Vision Assay Kit (SV0002-1) for IHC(P).

Application Details: Western blot,0.1-0.5 μg/mL
Immunohistochemistry(Paraffin-embedded Section),0.5-1 μg/mL

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.

Buffer: Each vial contains 4 mg Trehalose, 0.9 mg NaCl, 0.2 mg Na₂HPO₄, 0.05 mg NaN₃.

Agent conservateur: Sodium azide

Précaution d'utilisation: This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.

Stock: 4 °C,-20 °C

Stockage commentaire: At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20°C for a longer time. Avoid repeated freezing and thawing.

Détails sur FABP5

Antigène: FABP5 (Fatty Acid Binding Protein 5 (Psoriasis-Associated) (FABP5))

Autre désignation: FABP5 (FABP5 Produits)

Synonymes: anticorps E-FABP, anticorps EFABP, anticorps KFABP, anticorps PA-FABP, anticorps PAFABP, anticorps FABP5, anticorps Fabpe, anticorps Klbp, anticorps mal1, anticorps C-FABP, anticorps DA11, anticorps FABP5L1, anticorps fatty acid binding protein 5, anticorps fatty acid binding protein 5, epidermal, anticorps fatty acid binding protein 5 (psoriasis-associated), anticorps fatty acid binding protein 5 pseudogene 1, anticorps cationic amino acid transporter 3 pseudogene, anticorps FABP5, anticorps Fabp5, anticorps FABP5P1, anticorps LOC609554

Sujet:

Synonyms: Fatty acid-binding protein, epidermal, Epidermal-type fatty acid-binding protein, E-FABP, Fatty acid-binding protein 5, Psoriasis-associated fatty acid-binding protein homolog, PA-FABP, FABP5

Tissue Specificity: Keratinocytes, highly expressed in psoriatic skin.

Background: FABP5, Fatty acid-binding protein, epidermal, is a protein that in humans is encoded by the FABP5 gene. This gene encodes the fatty acid binding protein found in epidermal cells, and was first identified as being upregulated in psoriasis tissue. It is mapped to 8q21.13. Fatty acid binding proteins are a family of small, highly conserved, cytoplasmic proteins that bind long-chain fatty acids and other hydrophobic ligands. It is thought that FABPs roles include fatty acid uptake, transport, and metabolism.

UniProt: Q01469