NFIB anticorps
-
- Antigène Voir toutes NFIB Anticorps
- NFIB (Nuclear Factor I/B (NFIB))
-
Reactivité
- Humain, Souris, Rat
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp NFIB est non-conjugé
-
Application
- Western Blotting (WB), Immunohistochemistry (IHC)
- Marque
- Picoband™
- Séquence
- ELVRVSRTPI TQGTGVNFPI GEIPSQPYYH DMNSGVNLQR
- Réactivité croisée (Details)
- No cross reactivity with other proteins.
- Attributs du produit
- Rabbit IgG polyclonal antibody for NFIB/NF1B2 detection. Tested with WB, IHC-P in Human,Mouse,Rat.
- Immunogène
- A synthetic peptide corresponding to a sequence of human NFIB/NF1B2 (ELVRVSRTPITQGTGVNFPIGEIPSQPYYHDMNSGVNLQR).
- Top Product
- Discover our top product NFIB Anticorps primaire
-
-
- Indications d'application
-
Recommended Detection Systems: Enhanced Chemiluminescent Kit with anti-Rabbit IgG (ABIN921124) for Western blot, and HRP Conjugated anti-Rabbit IgG Super Vision Assay Kit (SV0002-1) for IHC(P).
Application Details: Western blot, 0.1-0.5 μg/mL
Immunohistochemistry(Paraffin-embedded Section), 0.5-1 μg/mL - Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.
- Buffer
- Each vial contains 4 mg Trehalose, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg NaN3.
- Agent conservateur
- Sodium azide
- Précaution d'utilisation
- This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
- Stock
- 4 °C,-20 °C
- Stockage commentaire
-
At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20°C for a longer time. Avoid repeated freezing and thawing.
-
- Antigène
- NFIB (Nuclear Factor I/B (NFIB))
- Autre désignation
- NFIB (NFIB Produits)
- Synonymes
- anticorps NFIB, anticorps nf1-b1, anticorps CTF, anticorps HMGIC/NFIB, anticorps NF-I/B, anticorps NF1-B, anticorps NFI-B, anticorps NFI-RED, anticorps NFIB2, anticorps NFIB3, anticorps 6720429L07Rik, anticorps E030026I10Rik, anticorps nuclear factor I B, anticorps nuclear factor 1 B-type, anticorps nuclear factor I B L homeolog, anticorps nuclear factor I/B, anticorps NFIB, anticorps LOC100221557, anticorps nfib.L, anticorps Nfib
- Sujet
-
Synonyms: Nuclear factor 1 B-type, NF1-B, Nuclear factor 1/B, CCAAT-box-binding transcription factor, CTF, Nuclear factor I/B, NF-I/B, NFI-B, TGGCA-binding protein, NFIB
- UniProt
- O00712
-