SP6 anticorps
-
- Antigène Voir toutes SP6 Anticorps
- SP6 (Sp6 Transcription Factor (SP6))
-
Reactivité
- Humain, Souris, Rat
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp SP6 est non-conjugé
-
Application
- Western Blotting (WB)
- Marque
- Picoband™
- Séquence
- QPDMSHHYES WFRPTHPGAE DGSWWDLHPG TSWMDLPH
- Réactivité croisée (Details)
- No cross reactivity with other proteins.
- Attributs du produit
- Rabbit IgG polyclonal antibody for SP6 detection. Tested with WB in Human,Mouse,Rat.
- Immunogène
- A synthetic peptide corresponding to a sequence of human SP6 (QPDMSHHYESWFRPTHPGAEDGSWWDLHPGTSWMDLPH).
- Top Product
- Discover our top product SP6 Anticorps primaire
-
-
- Indications d'application
-
Recommended Detection Systems: Enhanced Chemiluminescent Kit with anti-Rabbit IgG (ABIN921124) for Western blot.
Application Details: Western blot, 0.1-0.5 μg/mL
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.
- Buffer
- Each vial contains 4 mg Trehalose, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg NaN3.
- Agent conservateur
- Sodium azide
- Précaution d'utilisation
- This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
- Stock
- 4 °C,-20 °C
- Stockage commentaire
-
At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20°C for a longer time. Avoid repeated freezing and thawing.
-
- Antigène
- SP6 (Sp6 Transcription Factor (SP6))
- Autre désignation
- SP6 (SP6 Produits)
- Synonymes
- anticorps xsp6, anticorps MGC131081, anticorps EPFN, anticorps EPIPROFIN, anticorps KLF14, anticorps 1110025J03Rik, anticorps AA591031, anticorps AI592962, anticorps Epfn, anticorps Klf14, anticorps Sp6 transcription factor, anticorps Sp5 transcription factor L homeolog, anticorps trans-acting transcription factor 6, anticorps SP6, anticorps sp5.L, anticorps Sp6
- Sujet
-
Synonyms: Transcription factor Sp6, Krueppel-like factor 14, SP6, KLF14
Tissue Specificity: Ubiquitous.
Background: SP6 belongs to a family of transcription factors that contain 3 classical zinc finger DNA-binding domains consisting of a zinc atom tetrahedrally coordinated by 2 cysteines and 2 histidines (C2H2 motif). These transcription factors bind to GC-rich sequences and related GT and CACCC boxes. By somatic cell hybrid analysis and FISH, he SP6 gene is mapped t to chromosome 17q21.3-q22.
-