Cytokeratin 19 anticorps (C-Term)

N° du produit ABIN5693023

Détail du produit anti-Cytokeratin 19 anticorps

Antigène: Cytokeratin 19 (KRT19) (Keratin 19 (KRT19))

Épitope: AA 334-372, C-Term

Reactivité: Humain

Hôte: Souris

Clonalité: Monoclonal

Conjugué: Cet anticorp Cytokeratin 19 est non-conjugé

Application: Western Blotting (WB), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))

Marque: Picoband™

Séquence: QLAHIQALIS GIEAQLGDVR ADSERQNQEY QRLMDIKSR

Réactivité croisée (Details): No cross reactivity with other proteins.

Attributs du produit: Mouse IgG monoclonal antibody for Cytokeratin 19 detection. Tested with WB, IHC-P in Human.

Immunogène: A synthetic peptide corresponding to a sequence at the C-terminus of human Cytokeratin 19 (334-372aa QLAHIQALISGIEAQLGDVRADSERQNQEYQRLMDIKSR), different from the related mouse and rat sequences by nine amino acids.

Clone: 3D4

Isotype: IgG1

Information d'application

Indications d'application:

Recommended Detection Systems: Enhanced Chemiluminescent Kit with anti-Rabbit IgG (ABIN921124) for Western blot, and HRP Conjugated anti-Rabbit IgG Super Vision Assay Kit (SV0002-1) for IHC(P).

Application Details: Western blot, 0.1-0.5 μg/mL
Immunohistochemistry(Paraffin-embedded Section), 0.5-1 μg/mL

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.

Buffer: Each vial contains 4 mg Trehalose, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg Sodium azide.

Agent conservateur: Sodium azide

Précaution d'utilisation: This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.

Stock: 4 °C,-20 °C

Stockage commentaire: At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20°C for a longer time. Avoid repeated freezing and thawing.

Références pour anticorps anti-Cytokeratin 19 (ABIN5693023)

Wang, Said, Wang, Qu, Xu, Liu, Shen: "Establishment and evaluation of the goose embryo epithelial (GEE) cell line as a new model for propagation of avian viruses." dans: PLoS ONE, Vol. 13, Issue 3, pp. e0193876, (2018) (PubMed).

Quan, Du, Hou, Wang, Zhang: "Utilization of E-cadherin by monocytes from tumour cells plays key roles in the progression of bone invasion by oral squamous cell carcinoma." dans: Oncology reports, Vol. 38, Issue 2, pp. 850-858, (2017) (PubMed).

Jeng, Jeng, Jeng, Sheen, Li, Lu, Chang: "Tropism of liver epithelial cells toward hepatocellular carcinoma in vitro and in vivo with altering gene expression of cancer stem cells." dans: American journal of surgery, Vol. 215, Issue 4, pp. 735-743, (2017) (PubMed).

Li, Zhang, Zhang, Liu, Qi, Zhao, Jiang, Zhai, Ji, Luo: "Stem cell-like circulating tumor cells indicate poor prognosis in gastric cancer." dans: BioMed research international, Vol. 2014, pp. 981261, (2015) (PubMed).

Lu, Gu, Xu, Liu, Xie, Song: "Adult islets cultured in collagen gel transdifferentiate into duct-like cells." dans: World journal of gastroenterology, Vol. 11, Issue 22, pp. 3426-30, (2005) (PubMed).

Détails sur Cytokeratin 19

Antigène: Cytokeratin 19 (KRT19) (Keratin 19 (KRT19))

Autre désignation: KRT19 (KRT19 Produits)

Synonymes: anticorps CK19, anticorps K19, anticorps K1CS, anticorps AI663979, anticorps EndoC, anticorps Krt-1.19, anticorps Krt1-19, anticorps Ka19, anticorps k19, anticorps ck19, anticorps k1cs, anticorps krt9, anticorps krt15, anticorps MGC76282, anticorps GK-19, anticorps MGC83069, anticorps KRT19, anticorps keratin 19, anticorps keratin 19 L homeolog, anticorps keratin, type I cytoskeletal 19, anticorps KRT19, anticorps Krt19, anticorps krt19, anticorps krt19.L, anticorps LOC100344434, anticorps LOC101117946

Sujet:

Synonyms: Keratin, type I cytoskeletal 19, Cytokeratin-19, CK-19, Keratin-19, K19, KRT19

Tissue Specificity: Expressed in a defined zone of basal keratinocytes in the deep outer root sheath of hair follicles. Also observed in sweat gland and mammary gland ductal and secretory cells, bile ducts, gastrointestinal tract, bladder urothelium, oral epithelia, esophagus, ectocervical epithelium (at protein level). Expressed in epidermal basal cells, in nipple epidermis and a defined region of the hair follicle. Also seen in a subset of vascular wall cells in both the veins and artery of human umbilical cord, and in umbilical cord vascular smooth muscle. Observed in muscle fibers accumulating in the costameres of myoplasm at the sarcolemma in structures that contain dystrophin and spectrin.

Background: Keratin, type I cytoskeletal 19 is a protein that in humans is encoded by the KRT19 gene. The protein encoded by this gene is a member of the keratin family. It is specifically expressed in the periderm, the transiently superficial layer that envelops the developing epidermis. The type I cytokeratins are clustered in a region of chromosome 17q12-q21. Due to its high sensitivity, KRT19 is the most used marker for the RT-PCR-mediated detection of tumor cells disseminated in lymph nodes, peripheral blood, and bone marrow of breast cancer patients. Keratin 19 is often used together with keratin 8 and keratin 18 to differentiate cells of epithelial origin from hematopoietic cells in tests that enumerate circulating tumor cells in blood.

UniProt: P08727