JunD anticorps

N° du produit ABIN5693269

Détail du produit anti-JunD anticorps

Antigène: JunD (JUND) (Jun D Proto-Oncogene (JUND))

Reactivité: Humain, Rat, Souris

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp JunD est non-conjugé

Application: Western Blotting (WB)

Marque: Picoband™

Séquence: TASLLREQVA QLKQKVLSHV NSGCQLLPQH QVPAY

Réactivité croisée (Details): No cross reactivity with other proteins.

Attributs du produit: Rabbit IgG polyclonal antibody for JunD detection. Tested with WB in Human,Mouse,Rat.

Immunogène: A synthetic peptide corresponding to a sequence of human JunD (TASLLREQVAQLKQKVLSHVNSGCQLLPQHQVPAY).

Information d'application

Indications d'application:

Recommended Detection Systems: Enhanced Chemiluminescent Kit with anti-Rabbit IgG (ABIN921124) for Western blot.

Application Details: Western blot,0.1-0.5 μg/mL

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.

Buffer: Each vial contains 4 mg Trehalose, 0.9 mg NaCl, 0.2 mg Na₂HPO₄, 0.05 mg NaN₃.

Agent conservateur: Sodium azide

Précaution d'utilisation: This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.

Stock: 4 °C,-20 °C

Stockage commentaire: At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20°C for a longer time. Avoid repeated freezing and thawing.

Détails sur JunD

Antigène: JunD (JUND) (Jun D Proto-Oncogene (JUND))

Autre désignation: JUND (JUND Produits)

Synonymes: anticorps si:dkey-251j8.3, anticorps AP-1, anticorps Jund1, anticorps JunD proto-oncogene, AP-1 transcription factor subunit, anticorps jun D proto-oncogene S homeolog, anticorps jun D proto-oncogene, anticorps jund, anticorps jund.S, anticorps JUND, anticorps Jund

Sujet:

Synonyms: Transcription factor jun-D, JUND

Background: Transcription factor JunD is a protein that in humans is encoded by the JUND gene. The protein encoded by this intronless gene is a member of the JUN family, and a functional component of the AP1 transcription factor complex. This protein has been proposed to protect cells from p53-dependent senescence and apoptosis. Alternative translation initiation site usage results in the production of different isoforms.

UniProt: P17535