HBV Large S Protein anticorps (AA 4-51)

N° du produit ABIN5708085

L’anticorps Lapin Polyclonal anti-HBV Large S Protein a été validé pour WB et IHC (p). Il convient pour détecter HBV Large S Protein dans des échantillons de Hepatitis B Virus (HBV).

Aperçu rapide pour HBV Large S Protein anticorps (AA 4-51) (ABIN5708085)

Antigène: HBV Large S Protein (L-HBsAG) (Hepatitis B Virus Large Surface Protein (L-HBsAG))

Reactivité: Hepatitis B Virus (HBV)

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp HBV Large S Protein est non-conjugé

Application: Western Blotting (WB), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))

Détail du produit anti-HBV Large S Protein anticorps

Épitope: AA 4-51

Purification: Antigen affinity purified

Immunogène: Amino acids 4-51 (WSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDQ) from the human HBV Large S protein were used as the immunogen for the Hepatitis B Virus antibody.

Isotype: IgG

Information d'application

Indications d'application: Optimal dilution of the Hepatitis B Virus antibody should be determined by the researcher.\. WB: 0.5-1 μg/mL,IHC (FFPE): 1-2 μg/mL

Restrictions: For Research Use only

Stockage

Buffer: 0.5 mg/mL if reconstituted with 0.2 mL sterile DI water

Stock: -20 °C

Stockage commentaire: After reconstitution, the Hepatitis B Virus antibody can be stored for up to one month at 4°C. For long-term, aliquot and store at -20°C. Avoid repeated freezing and thawing.

Détails sur HBV Large S Protein

Antigène: HBV Large S Protein (L-HBsAG) (Hepatitis B Virus Large Surface Protein (L-HBsAG))

Autre désignation: Hepatitis B Virus (Large S Protein)

Classe de substances: Viral Protein

Sujet: Hepatitis B virus, abbreviated HBV, is a species of the genus Orthohepadnavirus, which is likewise a part of the Hepadnaviridae family of viruses. This virus causes the disease hepatitis B. It consists of HBsAg, HBcAg (HBeAg is a splice variant), Hepatitis B virus DNA polymerase and HBx. Among these, HBsAg (also known as the Australia antigen) is the surface antigen of the hepatitis B virus (HBV). It indicates current hepatitis B infection. The viral envelope of an enveloped virus has different surface proteins from the rest of the virus which act as antigens. These antigens are recognized by antibody proteins that bind specifically to one of these surface proteins.

UniProt: D2X4M3