Neuromedin B anticorps (AA 25-55) (Biotin)

N° du produit ABIN6294425

L’anticorps Lapin Polyclonal anti-Neuromedin B a été validé pour ELISA. Il convient pour détecter Neuromedin B dans des échantillons de Humain.

Aperçu rapide pour Neuromedin B anticorps (AA 25-55) (Biotin) (ABIN6294425)

Antigène: Neuromedin B

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp Neuromedin B est conjugé à/à la Biotin

Application: ELISA

Détail du produit anti-Neuromedin B anticorps (Biotin)

Épitope: AA 25-55

Fonction: Rabbit Anti-Human NMB (25-55aa) Antibody [+Biotin],

Immunogène: This antibody was produced from antiserum of rabbits immunized with a synthetic immunogen (NMB:25-55aa):APLSWDLPEPRSRASKIRVHSRGNLWATGHFC ).This antibody was produced from a rabbit immunized with this peptide conjugated with KLH.The IgG fraction of tissue culture supernatant was purified by Protein A affinity chromatography.

Information d'application

Indications d'application: ELISA (recommended work dilution= 1:64,000)

Restrictions: For Research Use only

Stockage

Reconstitution: A separate vial of dilution buffer is provided for reconstitution. The antibody is supplied lyophilized, originally containing PBS, without preservative stabilizers (e.g. sodium azide). The final amount is indicated on the shipping vial.

Stock: 4 °C,-20 °C,-80 °C

Stockage commentaire: -20°C

Détails sur Neuromedin B

Antigène: Neuromedin B

Autre désignation: Neuromedin-B

Sujet:

Target Description: Neuromedin B  (NMB) is a  bombesin-related  peptide  in mammals.  It was originally purified from pig spinal cord, and later shown to be present in human  central nervous system  and  gastrointestinal tract.

Gene Symbol: NMB

ID gène: 4828

UniProt: P08949