MBD1 anticorps (C-Term)

N° du produit ABIN629581

Cet anticorps Lapin Polyclonal détecte spécifiquement MBD1 dans WB. Il présente une réactivité envers Humain et Chien.

Aperçu rapide pour MBD1 anticorps (C-Term) (ABIN629581)

Antigène: MBD1 (Methyl-CpG Binding Domain Protein 1 (MBD1))

Reactivité: Humain, Chien

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp MBD1 est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-MBD1 anticorps

Épitope: C-Term

Specificité: MBD1 antibody was raised against the C terminal of MBD1

Purification: Purified

Immunogène: MBD1 antibody was raised using the C terminal of MBD1 corresponding to a region with amino acids VKQEPPDPEEDKEENKDDSASKLAPEEEAGGAGTPVITEIFSLGGTRFRD

Information d'application

Indications d'application: WB: 1.25 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

MBD1 Blocking Peptide, (ABIN5614686), is also available for use as a blocking control in assays to test for specificity of this MBD1 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of MBD1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur MBD1

Antigène: MBD1 (Methyl-CpG Binding Domain Protein 1 (MBD1))

Autre désignation: MBD1

Sujet: MBD1 belongs to a family of nuclear proteins related by the presence in each of a methyl-CpG binding domain (MBD). Each of these proteins, with the exception of MBD3, is capable of binding specifically to methylated DNA. MBD1 can also repress transcription from methylated gene promoters. Five transcript variants of the MBD1 are generated by alternative splicing resulting in protein isoforms that contain one MBD domain, two to three cysteine-rich (CXXC) domains, and some differences in the COOH terminus.

Poids moléculaire: 60 kDa (MW of target protein)