ECHDC3 anticorps (N-Term)

N° du produit ABIN629586

Cet anticorps anti-ECHDC3 est un anticorps Lapin Polyclonal détectant ECHDC3 dans WB. Adapté pour Humain, Souris et Rat.

Aperçu rapide pour ECHDC3 anticorps (N-Term) (ABIN629586)

Antigène: ECHDC3 (Enoyl CoA Hydratase Domain Containing 3 (ECHDC3))

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp ECHDC3 est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-ECHDC3 anticorps

Épitope: N-Term

Specificité: ECHDC3 antibody was raised against the N terminal of ECHDC3

Purification: Purified

Immunogène: ECHDC3 antibody was raised using the N terminal of ECHDC3 corresponding to a region with amino acids SLAMLKSLQSDILHDADSNDLKVIIISAEGPVFSSGHDLKELTEEQGRDY

Information d'application

Indications d'application: WB: 5 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

ECHDC3 Blocking Peptide, (ABIN5613296), is also available for use as a blocking control in assays to test for specificity of this ECHDC3 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ECHDC3 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur ECHDC3

Antigène: ECHDC3 (Enoyl CoA Hydratase Domain Containing 3 (ECHDC3))

Autre désignation: ECHDC3

Sujet: ECHDC3 possesses catalytic activity.

Poids moléculaire: 40 kDa (MW of target protein)