GMPR2 anticorps (C-Term)
-
- Antigène Voir toutes GMPR2 Anticorps
- GMPR2 (Guanosine Monophosphate Reductase 2 (GMPR2))
-
Épitope
- C-Term
-
Reactivité
- Humain, Souris
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp GMPR2 est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- GMPR2 antibody was raised against the C terminal of GMPR2
- Purification
- Purified
- Immunogène
- GMPR2 antibody was raised using the C terminal of GMPR2 corresponding to a region with amino acids GAGADFVMLGGMLAGHSESGGELIERDGKKYKLFYGMSSEMAMKKYAGGV
- Top Product
- Discover our top product GMPR2 Anticorps primaire
-
-
- Indications d'application
-
WB: 5 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
GMPR2 Blocking Peptide, catalog no. 33R-3152, is also available for use as a blocking control in assays to test for specificity of this GMPR2 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of GMPR2 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- GMPR2 (Guanosine Monophosphate Reductase 2 (GMPR2))
- Autre désignation
- GMPR2 (GMPR2 Produits)
- Sujet
- GMPR2 catalyzes the irreversible NADPH-dependent deamination of GMP to IMP. It functions in the conversion of nucleobase, nucleoside and nucleotide derivatives of G to A nucleotides, and in maintaining the intracellular balance of A and G nucleotides. It plays a role in modulating cellular differentiation.
- Poids moléculaire
- 20 kDa (MW of target protein)
-