CRYAB anticorps (C-Term)
-
- Antigène Voir toutes CRYAB Anticorps
- CRYAB (Crystallin, alpha B (CRYAB))
-
Épitope
- C-Term
-
Reactivité
- Humain, Souris
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp CRYAB est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- Crystallin Alpha B antibody was raised against the C terminal of CRYAB
- Purification
- Purified
- Immunogène
- Crystallin Alpha B antibody was raised using the C terminal of CRYAB corresponding to a region with amino acids KYRIPADVDPLTITSSLSSDGVLTVNGPRKQVSGPERTIPITREEKPAVT
- Top Product
- Discover our top product CRYAB Anticorps primaire
-
-
- Indications d'application
-
WB: 5 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
Crystallin Alpha B Blocking Peptide, catalog no. 33R-4750, is also available for use as a blocking control in assays to test for specificity of this Crystallin Alpha B antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CRYAB antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- CRYAB (Crystallin, alpha B (CRYAB))
- Autre désignation
- Crystallin alpha B (CRYAB Produits)
- Synonymes
- anticorps CMD1II, anticorps CRYA2, anticorps CTPP2, anticorps CTRCT16, anticorps HSPB5, anticorps MFM2, anticorps Crya-2, anticorps Crya2, anticorps HspB5, anticorps AACRYA, anticorps CRYAB, anticorps cryab, anticorps cryab2, anticorps wu:fe37f08, anticorps zgc:91937, anticorps crystallin alpha B, anticorps crystallin, alpha B, anticorps hypothetical protein, anticorps crystallin, alpha B, a, anticorps crystallin, alpha B, b, anticorps CRYAB, anticorps Cryab, anticorps ZK1128.7, anticorps cryaba, anticorps cryabb
- Sujet
- Alpha crystallins are composed of: alpha-A and alpha-B, for acidic and basic, respectively. They act as molecular chaperones although they do not renature proteins and release them in the fashion of a true chaperone, instead they hold them in large soluble aggregates. Post-translational modifications decrease the ability to chaperone. Two additional functions of alpha crystallins are an autokinase activity and participation in the intracellular architecture. Alpha-A and alpha-B are differentially expressed, alpha-A is preferentially restricted to the lens and alpha-B is expressed widely in many tissues and organs. Elevated expression of alpha-B crystallin occurs in many neurological diseases, a missense mutation cosegregated in a family with a desmin-related myopathy.
- Poids moléculaire
- 12 kDa (MW of target protein)
-