PHACS anticorps

N° du produit ABIN629591

L’anticorps Lapin Polyclonal anti-PHACS a été validé pour WB. Il convient pour détecter PHACS dans des échantillons de Humain, Souris et Rat.

Aperçu rapide pour PHACS anticorps (ABIN629591)

Antigène: PHACS (ACCS) (ACC Synthase-Like Protein 1 (ACCS))

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp PHACS est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-PHACS anticorps

Purification: Purified

Immunogène: PHACS antibody was raised using a synthetic peptide corresponding to a region with amino acids RSVLSLERLPDPQRTHVMWATSKDFGMSGLRFGTLYTENQDVATAVASLC

Information d'application

Indications d'application: WB: 2.5 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

PHACS Blocking Peptide, (ABIN5615340), is also available for use as a blocking control in assays to test for specificity of this PHACS antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PHACS antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur PHACS

Antigène: PHACS (ACCS) (ACC Synthase-Like Protein 1 (ACCS))

Autre désignation: PHACS

Sujet: PHACS does not catalyze the synthesis of 1-aminocyclopropane-1-carboxylate but is capable of catalyzing the deamination of L-vinylglycine.

Poids moléculaire: 42 kDa (MW of target protein)