PHACS anticorps

N° du produit ABIN629591

Détail du produit anti-PHACS anticorps

Antigène: PHACS (ACCS) (ACC Synthase-Like Protein 1 (ACCS))

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp PHACS est non-conjugé

Application: Western Blotting (WB)

Purification: Purified

Immunogène: PHACS antibody was raised using a synthetic peptide corresponding to a region with amino acids RSVLSLERLPDPQRTHVMWATSKDFGMSGLRFGTLYTENQDVATAVASLC

Information d'application

Indications d'application: WB: 2.5 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

PHACS Blocking Peptide, catalog no. 33R-8217, is also available for use as a blocking control in assays to test for specificity of this PHACS antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PHACS antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur PHACS

Antigène: PHACS (ACCS) (ACC Synthase-Like Protein 1 (ACCS))

Autre désignation: PHACS (ACCS Produits)

Synonymes: anticorps ACS, anticorps PHACS, anticorps 2610203E10Rik, anticorps Phacs, anticorps RGD1309314, anticorps fa10f06, anticorps wu:fa10f06, anticorps zgc:113217, anticorps 1-aminocyclopropane-1-carboxylate synthase homolog (inactive), anticorps 1-aminocyclopropane-1-carboxylate synthase (non-functional), anticorps 1-aminocyclopropane-1-carboxylate synthase homolog, anticorps 1-aminocyclopropane-1-carboxylate synthase homolog (Arabidopsis)(non-functional), anticorps ACCS, anticorps Accs, anticorps accs

Sujet: PHACS does not catalyze the synthesis of 1-aminocyclopropane-1-carboxylate but is capable of catalyzing the deamination of L-vinylglycine.

Poids moléculaire: 42 kDa (MW of target protein)