ESRP1 anticorps (N-Term)

N° du produit ABIN629592

Cet anticorps anti-ESRP1 est un anticorps Polyclonal produit chez le Lapin, détectant ESRP1 dans WB. Convient pour Humain, Souris et Rat.

Aperçu rapide pour ESRP1 anticorps (N-Term) (ABIN629592)

Antigène: ESRP1 (Epithelial Splicing Regulatory Protein 1 (ESRP1))

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp ESRP1 est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-ESRP1 anticorps

Épitope: N-Term

Specificité: RBM35 A antibody was raised against the N terminal of RBM35

Purification: Purified

Immunogène: RBM35 A antibody was raised using the N terminal of RBM35 corresponding to a region with amino acids MTEYLNFEKSSSVSRYGASQVEDMGNIILAMISEPYNHRFSDPERVNYKF

Information d'application

Indications d'application: WB: 5 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

RBM35A Blocking Peptide, (ABIN5615788), is also available for use as a blocking control in assays to test for specificity of this RBM35A antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RBM30 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur ESRP1

Antigène: ESRP1 (Epithelial Splicing Regulatory Protein 1 (ESRP1))

Autre désignation: RBM35A

Sujet: RBM35A functions as a tumor suppressor in colon cancer cells.

Poids moléculaire: 68 kDa (MW of target protein)