ESRP1 anticorps (N-Term)
-
- Antigène Voir toutes ESRP1 Anticorps
- ESRP1 (Epithelial Splicing Regulatory Protein 1 (ESRP1))
-
Épitope
- N-Term
-
Reactivité
- Humain, Souris, Rat
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp ESRP1 est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- RBM35 A antibody was raised against the N terminal of RBM35
- Purification
- Purified
- Immunogène
- RBM35 A antibody was raised using the N terminal of RBM35 corresponding to a region with amino acids MTEYLNFEKSSSVSRYGASQVEDMGNIILAMISEPYNHRFSDPERVNYKF
- Top Product
- Discover our top product ESRP1 Anticorps primaire
-
-
- Indications d'application
-
WB: 5 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
RBM35A Blocking Peptide, catalog no. 33R-6542, is also available for use as a blocking control in assays to test for specificity of this RBM35A antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RBM30 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- ESRP1 (Epithelial Splicing Regulatory Protein 1 (ESRP1))
- Autre désignation
- RBM35A (ESRP1 Produits)
- Synonymes
- anticorps rbm35a, anticorps RBM35A, anticorps RMB35A, anticorps 2210008M09Rik, anticorps A630065D16, anticorps BC031468, anticorps Rbm35a, anticorps RGD1560481, anticorps wu:fi28a07, anticorps zgc:154050, anticorps epithelial splicing regulatory protein 1, anticorps epithelial splicing regulatory protein 1 L homeolog, anticorps ESRP1, anticorps esrp1.L, anticorps Esrp1, anticorps esrp1
- Sujet
- RBM35A functions as a tumor suppressor in colon cancer cells.
- Poids moléculaire
- 68 kDa (MW of target protein)
-