ICEF1 anticorps (C-Term)

N° du produit ABIN629593

Cet anticorps Lapin Polyclonal détecte spécifiquement ICEF1 dans WB. Il présente une réactivité avec des échantillons de Humain.

Aperçu rapide pour ICEF1 anticorps (C-Term) (ABIN629593)

Antigène: ICEF1 (IPCEF1) (Interaction Protein For Cytohesin Exchange Factors 1 (IPCEF1))

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp ICEF1 est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-ICEF1 anticorps

Épitope: C-Term

Specificité: PIP3-E antibody was raised against the C terminal of PIP3-E

Purification: Purified

Immunogène: PIP3-E antibody was raised using the C terminal of PIP3-E corresponding to a region with amino acids DDPKLTARKYREWKVMNTLLIQDIYQQQRASPAPDDTDDTPQELKKSPSS

Information d'application

Indications d'application: WB: 2.5 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

PIP3-E Blocking Peptide, (ABIN937272), is also available for use as a blocking control in assays to test for specificity of this PIP3-E antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PIP3-E antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur ICEF1

Antigène: ICEF1 (IPCEF1) (Interaction Protein For Cytohesin Exchange Factors 1 (IPCEF1))

Autre désignation: PIP3-E

Sujet: PIP3-E enhances the promotion of guanine-nucleotide exchange by PSCD2 on ARF6 in a concentration-dependent manner.

Poids moléculaire: 44 kDa (MW of target protein)