TCP10L anticorps

N° du produit ABIN629595

Cet anticorps anti-TCP10L Polyclonal Lapin (ABIN629595) détecte spécifiquement TCP10L dans IHC et WB. L’anticorps est réactif avec des échantillons de Humain.

Aperçu rapide pour TCP10L anticorps (ABIN629595)

Antigène: TCP10L (T-Complex 10-Like (TCP10L))

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp TCP10L est non-conjugé

Application: Immunohistochemistry (IHC), Western Blotting (WB)

Détail du produit anti-TCP10L anticorps

Purification: Purified

Immunogène: TCP10 L antibody was raised using a synthetic peptide corresponding to a region with amino acids ASPHAGQESHTLALEPAFGKISPLSADEETIPKYAGHKNQSATLLGQRSS

Information d'application

Indications d'application: WB: 1.25 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

TCP10L Blocking Peptide, (ABIN936906), is also available for use as a blocking control in assays to test for specificity of this TCP10L antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TCP10 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur TCP10L

Antigène: TCP10L (T-Complex 10-Like (TCP10L))

Autre désignation: TCP10L

Sujet: TCP10L is a human leucine zipper protein with transcription inhibition activity.

Poids moléculaire: 24 kDa (MW of target protein)