CBR1 anticorps (C-Term)

N° du produit ABIN629599

Cet anticorps Lapin Polyclonal détecte spécifiquement CBR1 dans WB. Il présente une réactivité envers Humain et Souris.

Aperçu rapide pour CBR1 anticorps (C-Term) (ABIN629599)

Antigène: CBR1 (Carbonyl Reductase 1 (CBR1))

Reactivité: Humain, Souris

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp CBR1 est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-CBR1 anticorps

Épitope: C-Term

Specificité: Carbonyl Reductase 1 antibody was raised against the C terminal of CBR1

Purification: Purified

Immunogène: Carbonyl Reductase 1 antibody was raised using the C terminal of CBR1 corresponding to a region with amino acids PGWVRTDMAGPKATKSPEEGAETPVYLALLPPDAEGPHGQFVSEKRVEQW

Information d'application

Indications d'application: WB: 1.25 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

Carbonyl Reductase 1 Blocking Peptide, (ABIN5612608), is also available for use as a blocking control in assays to test for specificity of this Carbonyl Reductase 1 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CBR1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur CBR1

Antigène: CBR1 (Carbonyl Reductase 1 (CBR1))

Autre désignation: Carbonyl Reductase 1

Sujet: Carbonyl reductase is one of several monomeric, NADPH-dependent oxidoreductases having wide specificity for carbonyl compounds. This enzyme is widely distributed in human tissues. Another carbonyl reductase gene, CRB3, lies close to this gene on chromosome 21q.

Poids moléculaire: 30 kDa (MW of target protein)