CBR1 anticorps (C-Term)
-
- Antigène Voir toutes CBR1 Anticorps
- CBR1 (Carbonyl Reductase 1 (CBR1))
-
Épitope
- C-Term
-
Reactivité
- Humain, Souris
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp CBR1 est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- Carbonyl Reductase 1 antibody was raised against the C terminal of CBR1
- Purification
- Purified
- Immunogène
- Carbonyl Reductase 1 antibody was raised using the C terminal of CBR1 corresponding to a region with amino acids PGWVRTDMAGPKATKSPEEGAETPVYLALLPPDAEGPHGQFVSEKRVEQW
- Top Product
- Discover our top product CBR1 Anticorps primaire
-
anti-Carbonyl Reductase 1 (CBR1) (C-Term) antibody
Verified CBR1 Reactivité: Humain WB, ELISA, IHC, IF Hôte: Chèvre Polyclonal unconjugated
anti-Carbonyl Reductase 1 (CBR1) (AA 66-271) antibodyCBR1 Reactivité: Souris WB, IHC, ICC, IP Hôte: Lapin Polyclonal unconjugated
anti-Carbonyl Reductase 1 (CBR1) antibodyCBR1 Reactivité: Humain, Souris, Rat WB, ELISA, IHC Hôte: Lapin Polyclonal unconjugated
anti-Carbonyl Reductase 1 (CBR1) (AA 1-277) antibodyCBR1 Reactivité: Humain WB, IP Hôte: Lapin Polyclonal unconjugated
anti-Carbonyl Reductase 1 (CBR1) (AA 1-277) antibodyCBR1 Reactivité: Humain WB, ELISA Hôte: Souris Monoclonal 4D12-1G8 unconjugated
anti-Carbonyl Reductase 1 (CBR1) (AA 1-277) antibodyCBR1 Reactivité: Humain WB Hôte: Souris Polyclonal unconjugated
anti-Carbonyl Reductase 1 (CBR1) (Middle Region) antibodyCBR1 Reactivité: Humain, Souris, Rat, Porc, Lapin, Boeuf (Vache), Chien, Cobaye, Cheval, Poisson zèbre (Danio rerio) WB, IHC Hôte: Lapin Polyclonal unconjugated
anti-Carbonyl Reductase 1 (CBR1) (AA 176-268) antibodyCBR1 Reactivité: Humain WB, ELISA, IF Hôte: Lapin Polyclonal unconjugated
anti-Carbonyl Reductase 1 (CBR1) (C-Term) antibodyCBR1 Reactivité: Humain WB, IHC (p) Hôte: Lapin Polyclonal unconjugated
anti-Carbonyl Reductase 1 (CBR1) (C-Term) antibodyCBR1 Reactivité: Humain, Souris WB, ELISA, IHC, IF, ICC Hôte: Lapin Polyclonal unconjugated
-
- Indications d'application
-
WB: 1.25 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
Carbonyl Reductase 1 Blocking Peptide, catalog no. 33R-7140, is also available for use as a blocking control in assays to test for specificity of this Carbonyl Reductase 1 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CBR1 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- CBR1 (Carbonyl Reductase 1 (CBR1))
- Autre désignation
- Carbonyl Reductase 1 (CBR1 Produits)
- Synonymes
- anticorps LOC100222525, anticorps MGC131152, anticorps CBR, anticorps SDR21C1, anticorps hCBR1, anticorps 9-KPR, anticorps AW261796, anticorps CR, anticorps Cbr, anticorps carbonyl reductase 1, anticorps carbonyl reductase [NADPH] 1, anticorps carbonyl reductase 1 S homeolog, anticorps carbonyl reductase, anticorps cbr1, anticorps CBR1, anticorps LOC100222525, anticorps cbr1.S, anticorps Smp_033530.3, anticorps LOC610164, anticorps Cbr1
- Sujet
- Carbonyl reductase is one of several monomeric, NADPH-dependent oxidoreductases having wide specificity for carbonyl compounds. This enzyme is widely distributed in human tissues. Another carbonyl reductase gene, CRB3, lies close to this gene on chromosome 21q.
- Poids moléculaire
- 30 kDa (MW of target protein)
-
