eEF1A1 anticorps (C-Term)

N° du produit ABIN629602

Cet anticorps Lapin Polyclonal détecte spécifiquement eEF1A1 dans WB. Il présente une réactivité envers Humain, Souris et Rat.

Aperçu rapide pour eEF1A1 anticorps (C-Term) (ABIN629602)

Antigène: eEF1A1 (EEF1A1) (Eukaryotic Translation Elongation Factor 1 alpha 1 (EEF1A1))

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp eEF1A1 est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-eEF1A1 anticorps

Épitope: C-Term

Specificité: EEF1 A1 antibody was raised against the C terminal of EEF1 1

Purification: Purified

Immunogène: EEF1 A1 antibody was raised using the C terminal of EEF1 1 corresponding to a region with amino acids IVDMVPGKPMCVESFSDYPPLGRFAVRDMRQTVAVGVIKAVDKKAAGAGK

Information d'application

Indications d'application: WB: 2.5 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

EEF1A1 Blocking Peptide, (ABIN939582), is also available for use as a blocking control in assays to test for specificity of this EEF1A1 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of EEF0 1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur eEF1A1

Antigène: eEF1A1 (EEF1A1) (Eukaryotic Translation Elongation Factor 1 alpha 1 (EEF1A1))

Autre désignation: EEF1A1

Sujet: EEF1A1 is an isoform of the alpha subunit of the elongation factor-1 complex, which is responsible for the enzymatic delivery of aminoacyl tRNAs to the ribosome. This isoform (alpha 1) is expressed in brain, placenta, lung, liver, kidney, and pancreas, and the other isoform (alpha 2) is expressed in brain, heart and skeletal muscle. This isoform is identified as an autoantigen in 66% of patients with Felty syndrome.

Poids moléculaire: 50 kDa (MW of target protein)