eEF1A1 anticorps (C-Term)

N° du produit ABIN629602

Détail du produit anti-eEF1A1 anticorps

Antigène: eEF1A1 (EEF1A1) (Eukaryotic Translation Elongation Factor 1 alpha 1 (EEF1A1))

Épitope: C-Term

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp eEF1A1 est non-conjugé

Application: Western Blotting (WB)

Specificité: EEF1 A1 antibody was raised against the C terminal of EEF1 1

Purification: Purified

Immunogène: EEF1 A1 antibody was raised using the C terminal of EEF1 1 corresponding to a region with amino acids IVDMVPGKPMCVESFSDYPPLGRFAVRDMRQTVAVGVIKAVDKKAAGAGK

Information d'application

Indications d'application: WB: 2.5 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

EEF1A1 Blocking Peptide, catalog no. 33R-4196, is also available for use as a blocking control in assays to test for specificity of this EEF1A1 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of EEF0 1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur eEF1A1

Antigène: eEF1A1 (EEF1A1) (Eukaryotic Translation Elongation Factor 1 alpha 1 (EEF1A1))

Autre désignation: EEF1A1 (EEF1A1 Produits)

Synonymes: anticorps CCS-3, anticorps CCS3, anticorps EE1A1, anticorps EEF-1, anticorps EEF1A, anticorps EF-Tu, anticorps EF1A, anticorps GRAF-1EF, anticorps HNGC:16303, anticorps LENG7, anticorps PTI1, anticorps eEF1A-1, anticorps Eef1a2, anticorps Eef1a2l1, anticorps SI, anticorps EEF1A2, anticorps EF1A1, anticorps eef1a1, anticorps wu:fj34g08, anticorps zgc:110335, anticorps EEF1A1, anticorps RABEFLA2, anticorps EFL1-alpha, anticorps chunp6927, anticorps eef1a, anticorps ef1a, anticorps ik:tdsubc_2a3, anticorps ik:tdsubc_2b3, anticorps tdsubc_2a3, anticorps wu:fa91c07, anticorps wu:fa94b03, anticorps wu:fi13b09, anticorps xx:tdsubc_2a3, anticorps xx:tdsubc_2b3, anticorps EF-1A, anticorps EF-1-ALPHA-S, anticorps eef1a-s, anticorps eef1as, anticorps fj64c02, anticorps wu:fj64c02, anticorps zgc:73138, anticorps eukaryotic translation elongation factor 1 alpha 1, anticorps eukaryotic translation elongation factor 1 alpha 1b, anticorps eukaryotic translation elongation factor 1 alpha 1, like 1, anticorps eukaryotic translation elongation factor 1 alpha 1 L homeolog, anticorps elongation factor 1-alpha, anticorps eukaryotic translation elongation factor 1 alpha 1a, anticorps EEF1A1, anticorps Eef1a1, anticorps eef1a1b, anticorps eef1a1l1, anticorps eef1a1.L, anticorps tufA, anticorps eef1a1a

Sujet: EEF1A1 is an isoform of the alpha subunit of the elongation factor-1 complex, which is responsible for the enzymatic delivery of aminoacyl tRNAs to the ribosome. This isoform (alpha 1) is expressed in brain, placenta, lung, liver, kidney, and pancreas, and the other isoform (alpha 2) is expressed in brain, heart and skeletal muscle. This isoform is identified as an autoantigen in 66% of patients with Felty syndrome.

Poids moléculaire: 50 kDa (MW of target protein)