BMP2K anticorps (C-Term)

N° du produit ABIN629606

L’anticorps Lapin Polyclonal anti-BMP2K a été validé pour WB et IHC. Il convient pour détecter BMP2K dans des échantillons de Humain et Chien.

Aperçu rapide pour BMP2K anticorps (C-Term) (ABIN629606)

Antigène: BMP2K (BMP2 Inducible Kinase (BMP2K))

Reactivité: Humain, Chien

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp BMP2K est non-conjugé

Application: Western Blotting (WB), Immunohistochemistry (IHC)

Détail du produit anti-BMP2K anticorps

Épitope: C-Term

Specificité: BMP2 K antibody was raised against the C terminal of BMP2

Purification: Purified

Immunogène: BMP2 K antibody was raised using the C terminal of BMP2 corresponding to a region with amino acids AQHQPSQQQASPEYLTSPQEFSPALVSYTSSLPAQVGTIMDSSYSANRSV

Information d'application

Indications d'application: WB: 5 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

BMP2K Blocking Peptide, (ABIN936834), is also available for use as a blocking control in assays to test for specificity of this BMP2K antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of BMP0 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur BMP2K

Antigène: BMP2K (BMP2 Inducible Kinase (BMP2K))

Autre désignation: BMP2K

Sujet: BMP2K is the human homolog of mouse BMP-2-inducible kinase. Bone morphogenic proteins (BMPs) play a key role in skeletal development and patterning. BMP2K is thought to be a protein kinase with a putative regulatory role in attenuating the program of osteoblast differentiation. This gene is the human homolog of mouse BMP-2-inducible kinase. Bone morphogenic proteins (BMPs) play a key role in skeletal development and patterning.

Poids moléculaire: 74 kDa (MW of target protein)