PEBP1 anticorps (C-Term)

N° du produit ABIN629609

Détail du produit anti-PEBP1 anticorps

Antigène: PEBP1 (Phosphatidylethanolamine Binding Protein 1 (PEBP1))

Épitope: C-Term

Reactivité: Humain, Souris

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp PEBP1 est non-conjugé

Application: Western Blotting (WB)

Specificité: PEBP1 antibody was raised against the C terminal of PEBP1

Purification: Purified

Immunogène: PEBP1 antibody was raised using the C terminal of PEBP1 corresponding to a region with amino acids LSNRSGDHRGKFKVASFRKKYELRAPVAGTCYQAEWDDYVPKLYEQLSGK

Information d'application

Indications d'application: WB: 1.25 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

PEBP1 Blocking Peptide, catalog no. 33R-5442, is also available for use as a blocking control in assays to test for specificity of this PEBP1 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PEBP1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur PEBP1

Antigène: PEBP1 (Phosphatidylethanolamine Binding Protein 1 (PEBP1))

Autre désignation: PEBP1 (PEBP1 Produits)

Synonymes: anticorps HCNP, anticorps HCNPpp, anticorps PBP, anticorps PEBP, anticorps PEBP-1, anticorps RKIP, anticorps pbp, anticorps hcnp, anticorps pebp, anticorps rkip, anticorps Pbp, anticorps Pbp1, anticorps Pbpr, anticorps Rkip, anticorps PEBP1, anticorps BcDNA:LP12095, anticorps CG18594, anticorps Dmel\\CG18594, anticorps T2, anticorps zgc:56033, anticorps zgc:76942, anticorps phosphatidylethanolamine binding protein 1, anticorps phosphatidylethanolamine binding protein 1 L homeolog, anticorps phosphatidylethanolamine-binding protein, anticorps phosphatidylethanolamine-binding protein,putative, anticorps Phosphatidylethanolamine-binding protein 1, anticorps PEBP1, anticorps pebp1, anticorps Pebp1, anticorps pebp1.L, anticorps RR_RS07785, anticorps PVX_235290, anticorps PVX_123630, anticorps PKH_143640, anticorps EAM_1207

Sujet: PEBP1 binds ATP, opioids and phosphatidylethanolamine. It has lower affinity for phosphatidylinositol and phosphatidylcholine. It is also a serine protease inhibitor which inhibits thrombin, neuropsin and chymotrypsin but not trypsin, tissue type plasminogen activator and elastase.

Poids moléculaire: 21 kDa (MW of target protein)

Pathways: Feeding Behaviour