PRMT2 anticorps (N-Term)

N° du produit ABIN629611

Cet anticorps Lapin Polyclonal détecte spécifiquement PRMT2 dans WB et IHC. Il présente une réactivité avec des échantillons de Humain, Rat et Souris.

Aperçu rapide pour PRMT2 anticorps (N-Term) (ABIN629611)

Antigène: PRMT2 (Protein Arginine Methyltransferase 2 (PRMT2))

Reactivité: Humain, Rat, Souris

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp PRMT2 est non-conjugé

Application: Western Blotting (WB), Immunohistochemistry (IHC)

Détail du produit anti-PRMT2 anticorps

Épitope: N-Term

Specificité: PRMT2 antibody was raised against the N terminal of PRMT2

Purification: Purified

Immunogène: PRMT2 antibody was raised using the N terminal of PRMT2 corresponding to a region with amino acids ESQGEEPAECSEAGLLQEGVQPEEFVAIADYAATDETQLSFLRGEKILIL

Information d'application

Indications d'application: WB: 0.625 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

PRMT2 Blocking Peptide, (ABIN938128), is also available for use as a blocking control in assays to test for specificity of this PRMT2 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PRMT2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur PRMT2

Antigène: PRMT2 (Protein Arginine Methyltransferase 2 (PRMT2))

Autre désignation: PRMT2

Sujet: The protein arginine methyltransferases (PRMTs) include a family of proteins with related putative methyltransferase domains that modify chromatin and regulate cellular transcription. PRMT2 inhibits NF-kappaB-dependent transcription and promotes apoptosis and it exerts this effect by blocking nuclear export of IkappaB-alpha through a leptomycin-sensitive pathway, increasing nuclear IkappaB-alpha and decreasing NF-kappaB DNA binding. PRMT2 also rendered cells susceptible to apoptosis by cytokines or cytotoxic drugs, likely due to its effects on NF-kappaB.

Poids moléculaire: 48 kDa (MW of target protein)

Pathways: Intracellular Steroid Hormone Receptor Signaling Pathway, Regulation of Intracellular Steroid Hormone Receptor Signaling, Nuclear Hormone Receptor Binding