POLR2H anticorps (N-Term)

N° du produit ABIN629625

Détail du produit anti-POLR2H anticorps

Antigène: POLR2H (Polymerase (RNA) II (DNA Directed) Polypeptide H (POLR2H))

Épitope: N-Term

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp POLR2H est non-conjugé

Application: Western Blotting (WB)

Specificité: POLR2 H antibody was raised against the N terminal of POLR2

Purification: Purified

Immunogène: POLR2 H antibody was raised using the N terminal of POLR2 corresponding to a region with amino acids DLGDKFRLVIASTLYEDGTLDDGEYNPTDDRPSRADQFEYVMYGKVYRIE

Information d'application

Indications d'application: WB: 5 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

POLR2H Blocking Peptide, catalog no. 33R-2043, is also available for use as a blocking control in assays to test for specificity of this POLR2H antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of POLR0 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur POLR2H

Antigène: POLR2H (Polymerase (RNA) II (DNA Directed) Polypeptide H (POLR2H))

Autre désignation: POLR2H (POLR2H Produits)

Synonymes: anticorps RPABC3, anticorps RPB17, anticorps RPB8, anticorps POLR2H, anticorps RGD1561203, anticorps rpb8, anticorps rpb17, anticorps hsrpb8, anticorps rpabc3, anticorps zgc:110289, anticorps RNA polymerase II subunit H, anticorps polymerase (RNA) II (DNA directed) polypeptide H, anticorps polymerase (RNA) II subunit H L homeolog, anticorps polymerase (RNA) II subunit H, anticorps info polymerase (RNA) II (DNA directed) polypeptide H, anticorps POLR2H, anticorps Polr2h, anticorps polr2h.L, anticorps polr2h

Sujet: This gene encodes one of the essential subunits of RNA polymerase II that is shared by the other two eukaryotic DNA-directed RNA polymerases, I and III. This gene encodes a member of the E2F transcription factor protein family. E2F family members play a crucial role in control of the cell cycle and of the action of tumor suppressor proteins.

Poids moléculaire: 17 kDa (MW of target protein)

Pathways: Regulatory RNA Pathways