Deoxyuridine Triphosphatase (DUT) (C-Term) anticorps

N° du produit ABIN629626

Cet anticorps Lapin Polyclonal détecte spécifiquement dans WB et IHC. Il présente une réactivité envers Humain, Rat, Souris et Chien.

Aperçu rapide pour Deoxyuridine Triphosphatase (DUT) (C-Term) anticorps (ABIN629626)

Antigène: Deoxyuridine Triphosphatase (DUT)

Reactivité: Humain, Rat, Souris, Chien

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Inconjugué

Application: Western Blotting (WB), Immunohistochemistry (IHC)

Détail du produit

Épitope: C-Term

Specificité: DUT antibody was raised against the C terminal of DUT

Purification: Purified

Immunogène: DUT antibody was raised using the C terminal of DUT corresponding to a region with amino acids NFGKEKFEVKKGDRIAQLICERIFYPEIEEVQALDDTERGSGGFGSTGKN

Information d'application

Indications d'application: WB: 2.5 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

DUT Blocking Peptide, (ABIN5613272), is also available for use as a blocking control in assays to test for specificity of this DUT antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of DUT antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détail du antigène

Antigène: Deoxyuridine Triphosphatase (DUT)

Autre désignation: DUT

Sujet: DUT is an essential enzyme of nucleotide metabolism. This protein forms a ubiquitous, homotetrameric enzyme that hydrolyzes dUTP to dUMP and pyrophosphate. This reaction serves two cellular purposes: providing a precursor (dUMP) for the synthesis of thymine nucleotides needed for DNA replication, and limiting intracellular pools of dUTP. Elevated levels of dUTP lead to increased incorporation of uracil into DNA, which induces extensive excision repair mediated by uracil glycosylase. This repair process, resulting in the removal and reincorporation of dUTP, is self-defeating and leads to DNA fragmentation and cell death.

Poids moléculaire: 19 kDa (MW of target protein)