WDR12 anticorps (C-Term)

N° du produit ABIN629636

L’anticorps Lapin Polyclonal anti-WDR12 a été validé pour WB. Il convient pour détecter WDR12 dans des échantillons de Humain, Souris, Rat et Chien.

Aperçu rapide pour WDR12 anticorps (C-Term) (ABIN629636)

Antigène: WDR12 (WD Repeat Domain 12 (WDR12))

Reactivité: Humain, Souris, Rat, Chien

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp WDR12 est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-WDR12 anticorps

Épitope: C-Term

Specificité: WDR12 antibody was raised against the C terminal of WDR12

Purification: Purified

Immunogène: WDR12 antibody was raised using the C terminal of WDR12 corresponding to a region with amino acids DTRSCKAPLYDLAAHEDKVLSVDWTDTGLLLSGGADNKLYSYRYSPTTSH

Information d'application

Indications d'application: WB: 5 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

WDR12 Blocking Peptide, (ABIN937595), is also available for use as a blocking control in assays to test for specificity of this WDR12 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of WDR12 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur WDR12

Antigène: WDR12 (WD Repeat Domain 12 (WDR12))

Autre désignation: WDR12

Sujet: WDR12 is a member of the WD repeat protein family. WD repeats are minimally conserved regions of approximately 40 amino acids typically bracketed by gly-his and trp-asp (GH-WD), which may facilitate formation of heterotrimeric or multiprotein complexes. Members of this family are involved in a variety of cellular processes, including cell cycle progression, signal transduction, apoptosis, and gene regulation. The function of this protein is not known.

Poids moléculaire: 47 kDa (MW of target protein)