CACYBP anticorps (Middle Region)

N° du produit ABIN629637

Cet anticorps anti-CACYBP est un anticorps Lapin Polyclonal détectant CACYBP dans WB. Adapté pour Humain et Chien.

Aperçu rapide pour CACYBP anticorps (Middle Region) (ABIN629637)

Antigène: CACYBP (Calcyclin Binding Protein (CACYBP))

Reactivité: Humain, Chien

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp CACYBP est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-CACYBP anticorps

Épitope: Middle Region

Specificité: CACYBP antibody was raised against the middle region of CACYBP

Purification: Purified

Immunogène: CACYBP antibody was raised using the middle region of CACYBP corresponding to a region with amino acids FTERSFDLLVKNLNGKSYSMIVNNLLKPISVEGSSKKVKTDTVLILCRKK

Information d'application

Indications d'application: WB: 5 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

CACYBP Blocking Peptide, (ABIN938475), is also available for use as a blocking control in assays to test for specificity of this CACYBP antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CACYBP antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur CACYBP

Antigène: CACYBP (Calcyclin Binding Protein (CACYBP))

Autre désignation: CACYBP

Sujet: CACYBP is a calcyclin binding protein. It may be involved in calcium-dependent ubiquitination and subsequent proteosomal degradation of target proteins. It probably serves as a molecular bridge in ubiquitin E3 complexes and participates in the ubiquitin-mediated degradation of beta-catenin.

Poids moléculaire: 26 kDa (MW of target protein)

Pathways: Response to Growth Hormone Stimulus