RSRC2 anticorps (C-Term)

N° du produit ABIN629642

Détail du produit anti-RSRC2 anticorps

Antigène: RSRC2 (arginine/serine-Rich Coiled-Coil 2 (RSRC2))

Épitope: C-Term

Reactivité: Humain, Souris, Chien, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp RSRC2 est non-conjugé

Application: Western Blotting (WB), Immunohistochemistry (IHC)

Specificité: RSRC2 antibody was raised against the C terminal of RSRC2

Purification: Purified

Immunogène: RSRC2 antibody was raised using the C terminal of RSRC2 corresponding to a region with amino acids DQNVKFRKLMGIKSEDEAGCSSVDEESYKTLKQQEEVFRNLDAQYEMARS

Information d'application

Indications d'application: WB: 2.5 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

RSRC2 Blocking Peptide, catalog no. 33R-2134, is also available for use as a blocking control in assays to test for specificity of this RSRC2 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RSRC2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur RSRC2

Antigène: RSRC2 (arginine/serine-Rich Coiled-Coil 2 (RSRC2))

Autre désignation: RSRC2 (RSRC2 Produits)

Synonymes: anticorps 1500011J06Rik, anticorps flj11021, anticorps ik:tdsubc_1d5, anticorps si:ch211-110p13.2, anticorps wu:fc56g08, anticorps xx:tdsubc_1d5, anticorps zgc:85695, anticorps arginine and serine rich coiled-coil 2, anticorps arginine/serine-rich coiled-coil 2, anticorps arginine/serine-rich coiled-coil 2 L homeolog, anticorps RSRC2, anticorps Rsrc2, anticorps rsrc2.L, anticorps rsrc2

Sujet: In vitro study revealed that RSRC2 might play a role in cell proliferation. RSRC2 may be a novel tumor suppressor of esophageal cancer cell growth.

Poids moléculaire: 50 kDa (MW of target protein)