RSRC2 anticorps (C-Term)

N° du produit ABIN629642

L’anticorps anti-RSRC2 Polyclonal Lapin est utilisé pour la détection de RSRC2 dans des échantillons de Humain, Souris, Chien et Rat. Il a été validé pour WB et IHC.

Aperçu rapide pour RSRC2 anticorps (C-Term) (ABIN629642)

Antigène: RSRC2 (arginine/serine-Rich Coiled-Coil 2 (RSRC2))

Reactivité: Humain, Souris, Chien, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp RSRC2 est non-conjugé

Application: Western Blotting (WB), Immunohistochemistry (IHC)

Détail du produit anti-RSRC2 anticorps

Épitope: C-Term

Specificité: RSRC2 antibody was raised against the C terminal of RSRC2

Purification: Purified

Immunogène: RSRC2 antibody was raised using the C terminal of RSRC2 corresponding to a region with amino acids DQNVKFRKLMGIKSEDEAGCSSVDEESYKTLKQQEEVFRNLDAQYEMARS

Information d'application

Indications d'application: WB: 2.5 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

RSRC2 Blocking Peptide, (ABIN937520), is also available for use as a blocking control in assays to test for specificity of this RSRC2 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RSRC2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur RSRC2

Antigène: RSRC2 (arginine/serine-Rich Coiled-Coil 2 (RSRC2))

Autre désignation: RSRC2

Sujet: In vitro study revealed that RSRC2 might play a role in cell proliferation. RSRC2 may be a novel tumor suppressor of esophageal cancer cell growth.

Poids moléculaire: 50 kDa (MW of target protein)