PCMTD1 anticorps

N° du produit ABIN629648

L’anticorps Lapin Polyclonal anti-PCMTD1 a été validé pour WB. Il convient pour détecter PCMTD1 dans des échantillons de Humain, Souris et Rat.

Aperçu rapide pour PCMTD1 anticorps (ABIN629648)

Antigène: PCMTD1 (Protein-L-Isoaspartate (D-Aspartate) O-Methyltransferase Domain Containing 1 (PCMTD1))

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp PCMTD1 est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-PCMTD1 anticorps

Purification: Purified

Immunogène: PCMTD1 antibody was raised using a synthetic peptide corresponding to a region with amino acids TGQNTWESKNILAVSFAPLVQPSKNDNGKPDSVGLPPCAVRNLQDLARIY

Information d'application

Indications d'application: WB: 2.5 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

PCMTD1 Blocking Peptide, (ABIN5615259), is also available for use as a blocking control in assays to test for specificity of this PCMTD1 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PCMTD1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur PCMTD1

Antigène: PCMTD1 (Protein-L-Isoaspartate (D-Aspartate) O-Methyltransferase Domain Containing 1 (PCMTD1))

Autre désignation: PCMTD1

Sujet: The function of PCMTD1 protein is not widely studied, and is yet to be elucidated fully.

Poids moléculaire: 41 kDa (MW of target protein)